KEGG   Shewanella loihica: Shew_0019Help
Entry
Shew_0019         CDS       T00489                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
slo  Shewanella loihica
Pathway
slo00071  Fatty acid degradation
slo00280  Valine, leucine and isoleucine degradation
slo00281  Geraniol degradation
slo00310  Lysine degradation
slo00362  Benzoate degradation
slo00380  Tryptophan metabolism
slo00410  beta-Alanine metabolism
slo00640  Propanoate metabolism
slo00650  Butanoate metabolism
slo00903  Limonene and pinene degradation
slo00930  Caprolactam degradation
slo01040  Biosynthesis of unsaturated fatty acids
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
slo01200  Carbon metabolism
slo01212  Fatty acid metabolism
Module
slo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Shew_0019
   00650 Butanoate metabolism
    Shew_0019
  Lipid metabolism
   00071 Fatty acid degradation
    Shew_0019
   01040 Biosynthesis of unsaturated fatty acids
    Shew_0019
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shew_0019
   00310 Lysine degradation
    Shew_0019
   00380 Tryptophan metabolism
    Shew_0019
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shew_0019
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Shew_0019
   00281 Geraniol degradation
    Shew_0019
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shew_0019
   00930 Caprolactam degradation
    Shew_0019
Enzymes [BR:slo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Shew_0019
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Shew_0019
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Shew_0019
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Shew_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ABO21892
JGI: Shew0019
UniProt: A3Q8U4
Position
complement(21039..23189)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIARLCFNAEGSVNKFDRETLNSLNDALDALAQTQGVKGLMLTSG
KDAFIVGADITEFLGLFAQDDNVLQGWLEDANKVFNKLEDLPFPTISAIKGFALGGGCET
ILATDLRIADTSARIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRPEAALK
VGAIDAVVAPELLETAACQMLQDAISEKIDWQARRQRKLSPLTLPKLEAMMSFATAKGMV
FKVAGKHYPAPMAVVEVIEKAALSERAEALQVEHQAFIKLAKTDVAKALIGIFLNDQLVK
GKAKKAAKQAQAVNSAAVLGAGIMGGGIAYQSASKGTPIVMKDINQAALDLGLNEAAKLL
TAQINRGRSTPAKMAGVLNNITATLDYNALKQADVVVEAVVEHPKVKATVLAEVEQVVGE
DAIITSNTSTISINLLAKSLQKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETVASVVAY
AAKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLEDGADFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMAKEGKDAIDVMFEADRFGQKNGKGFYQYSVDRRGKP
KKEVDPLSYELLGNAFGEQKEFSSDEIIARTMIPMIIETVRCLEEGIIATPAEADMGLVY
GLGFPPFRGGVFRYLDTLGVANFVALADQYAHLGGLYQVTDKMRELAATNGSYYPA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacgattcaagtggaattacttgaagacaatatcgctcggctc
tgttttaacgccgagggctcagtcaataagtttgatcgagagaccctcaactcccttaac
gacgcactcgatgccctagcacaaacccaaggggttaagggcctgatgctcacctcgggc
aaagatgcctttatcgtaggcgccgatatcacagaattcctgggactttttgcacaagac
gacaacgtgctacagggctggctggaagacgccaacaaggtgttcaacaagctcgaagat
ctgcccttcccaactatctcagccatcaaaggcttcgccctgggcggcggctgcgaaact
atcctagccactgacttacgtatcgccgatacctcggcgcgtatcggcctgccagagact
aagctgggcatcatcccaggctttggtggtacagtgcgtctgcctcgcgtgataggtgcc
gacaacgcacttgagtggatcaccacaggtaaagatcaacgcccggaagccgccctcaag
gttggcgccatcgacgccgtagttgctccagaattgctggaaacggcggcgtgccagatg
ctgcaagatgccatcagcgagaaaattgactggcaagcccgtcgtcagcgcaaactgtcg
ccgctgaccctgcctaagttggaagccatgatgtcatttgccaccgccaagggcatggta
ttcaaggttgccggtaaacactatcctgcgccaatggctgttgtcgaggtgatcgagaaa
gccgccttgagcgagcgcgccgaggcactacaggtagaacatcaagccttcatcaagctg
gccaagacagacgtggccaaggcacttatcggtatcttccttaacgaccaactagttaaa
ggcaaggccaagaaggcagccaaacaggcacaggcggttaactccgccgccgtgctgggc
gcaggcatcatgggtggcggtatcgcctaccagagcgcaagcaagggcacgcctatcgtg
atgaaagatatcaatcaggcggcactggatcttggcctcaacgaggcagccaagctgctc
acggcgcagatcaatcgtggtcgctctacaccagccaagatggcgggcgtgctcaacaac
atcacggcaaccctagactacaacgcacttaagcaagccgatgtcgttgtcgaagcagtg
gtcgagcatcctaaggtgaaggcgaccgtactggcggaagtcgagcaggtcgtgggcgaa
gatgccatcatcacctctaacacctccaccatctcaatcaatctgctggccaagagcctg
cagaaacctgagcgcttctgtggcatgcacttcttcaacccggtacacaagatgccactg
gttgaggtgatccgcggcgagcatagctcagaagagacagttgcctctgtcgtggcttac
gccgccaagatgggcaagacgcccatcgtggtcaacgactgcccaggcttcttcgttaac
cgtgtgctcttcccctacttcgccggtttcagcggcctgctagaagatggcgccgacttt
gctgccatcgacaaggtgatggagaagcaattcggttggcctatgggccccgcctaccta
cttgacgtagttggtctggacacgggtcatcacgcccaggccgttatggccgaaggcttc
cctgacagaatggctaaagaaggcaaagacgccatcgacgtcatgttcgaagccgatcgt
ttcggtcagaagaatggcaaaggcttctaccaatattcggtggatcgtcgtggcaagcct
aagaaagaggtcgacccactcagctatgaactactgggcaacgccttcggtgagcagaag
gagttcagcagtgacgagatcatcgcccgcaccatgatccctatgatcatcgaaacggtt
cgttgtctggaagaaggcatcatagccacgccggccgaagccgatatgggactcgtttat
ggactcggtttccctccattcagaggaggtgtgttccgctacctagacaccttaggtgtc
gctaacttcgtcgcccttgccgatcagtacgcccacctgggtggcctgtatcaggtaacc
gacaagatgcgtgaactggctgccaccaacggcagttactacccagcctaa

DBGET integrated database retrieval system