KEGG   Shewanella loihica: Shew_0696Help
Entry
Shew_0696         CDS       T00489                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
slo  Shewanella loihica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shew_0696
Enzymes [BR:slo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Shew_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(789076..789990)
Genome map
AA seq 304 aa AA seqDB search
MTRLLILGSANADHVMNLEHLPSAGQTLMSRGYRLEHGGKGANQAVAAARLSKDETRVDF
ICHLGRDAIGQAMAQAWQQDGIMPYGITYTDDQPTGTAMIFVADKGENIIGVSAGANATL
TPEALEAHLELIEKADYLLVQLETPAVTVLDALKHAKKHGVTTILNPAPAMVIGKDLFRL
VDVITPNETEAEAITGIEVTDEQSARMAAQMLHQFGPQTVIITLGKQGALLSTKDYCALI
PGVQVKAVDTVAAGDTFNGALMVALGEGKSVEEAVAFAHRAAAISVTRAGAQRAIPYRHE
LADI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccagactgttaatcctcggcagtgccaatgccgatcatgtgatgaacctggaacac
ctgcctagcgcaggacagactctgatgagtcgcggctataggctggaacacggcggcaag
ggggctaatcaggcggtggccgccgcacgccttagcaaggacgagacccgggtcgacttc
atctgtcatctgggccgggacgccataggtcaggcgatggcccaggcctggcagcaagat
ggcataatgccctacggcatcacctatacggacgatcaacccacaggcacggcgatgatc
ttcgtcgccgataaaggcgagaacatcataggcgtctcagccggcgccaacgcgaccctg
acccccgaggcgctcgaggcccatcttgagctgatcgaaaaggccgattatctgctggtg
cagctggagaccccggcggtgactgtgctggatgccttaaagcacgccaagaagcatggc
gtgaccaccatactcaatcccgcgccggccatggtgatcggcaaagatctgttccgcctg
gtggatgtgatcacccccaacgagacagaggccgaagccatcacaggcatagaggtgacc
gatgagcagagcgccagaatggcggcgcagatgctgcatcaattcgggccgcagacggtg
atcatcaccctgggcaagcaaggtgccctgctcagcaccaaggactattgcgccctgatc
ccaggcgttcaggtgaaagccgtagacacggtcgccgccggcgatacctttaacggcgcc
ctcatggtggcccttggcgagggcaagtctgtcgaggaggcggtcgcctttgcccaccgc
gccgccgccatctcggtgacccgcgccggtgcccagcgcgccatcccctatcgccacgaa
ctggcagatatctag

DBGET integrated database retrieval system