KEGG   Shewanella loihica: Shew_0771Help
Entry
Shew_0771         CDS       T00489                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
slo  Shewanella loihica
Brite
Enzymes [BR:slo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Shew_0771
Secretion system [BR:slo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Shew_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
880241..880966
Genome map
AA seq 241 aa AA seqDB search
MKFTRALTLVVAMVATPLMAASNNVVDNGDQLKQKLSDTLGVEVQNLSQSPIPGLYEAIT
NRGVLYISKDGSKLFHGNLYDLDNGMKNLTEAALAGPRMEAIKPFEPNMLVYKAKDEKHV
VTVFTDITCGYCRKLHNQMAEYNDLGITVRYLAFPRQGVPSKNAVDMEAVWCSADPLKAM
TDAKAGKQVSGAKCDAKIAQQYQLGQSLGVNGTPAIILEDGTMIPGYQPPEQLLQVLDRV
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttacccgagcgctcaccttagttgttgccatggtggccacgcctctaatggcg
gcatcaaacaacgtggtcgacaatggcgaccagttgaagcagaaattatcagatacccta
ggcgtcgaggtgcaaaaccttagccagtcgccaatcccaggcctgtatgaggcgatcacc
aaccgtggcgtgctctacatcagcaaagacggcagcaagctgtttcacggtaacctgtac
gatctcgacaacggcatgaagaacctcaccgaggcggcattagccggtccgcgtatggaa
gcgatcaagccgtttgagccaaacatgctggtctacaaggccaaggatgagaagcatgtg
gtgaccgtatttaccgacatcacctgtggctactgccgcaagttacacaatcagatggcc
gagtataacgacttaggcatcacggtacgttatctggccttccctcgtcagggcgtgccg
tctaaaaacgcagtggatatggaagccgtatggtgctcggccgatccgctcaaggcaatg
acagatgccaaggcgggtaagcaggtttcgggggctaagtgtgatgctaagatcgctcag
cagtatcaacttgggcagagtcttggggtgaacggcacgccagccattatcttggaagac
ggtaccatgatcccgggttatcagccgcctgagcagctactccaggtgctggaccgcgtc
caataa

DBGET integrated database retrieval system