KEGG   Shewanella loihica: Shew_1003Help
Entry
Shew_1003         CDS       T00489                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
slo  Shewanella loihica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:slo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1160725..1161216
Genome map
AA seq 163 aa AA seqDB search
MARIFISIGSNIHPEGYFNAALKALSTHFDNLCLSSVFESEAVGFDGSNFLNMVVAADTQ
LGIAEVVALFKQIESDNGRLPGAKKFSPRTLDLDLLLYDDLVTETPIVLPRAEITTNAFV
LWPLAEIAPERVHPVAQLSYQTLWDNYDKSQQKLWPVEFQWSY
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcatcttcatcagcattggcagtaatattcaccctgagggctactttaacgcc
gccctcaaggccttaagcactcacttcgataacctatgcctctccagcgtctttgagagc
gaggcggtcggtttcgatggcagcaattttctcaacatggtggtcgccgccgatacccag
cttggtatcgccgaggtggtggcgctgtttaaacagatagagtcggataatggcaggctg
ccgggggcgaagaagtttagccctcgcaccctagatctcgacctgctgctctatgacgac
ttggtgaccgagacgcccatagtgctgccgcgcgccgagatcaccaccaacgccttcgtg
ctctggccgctggcggagatcgcccccgagcgggtccatcccgtggcgcagctttcttat
cagaccctatgggacaattatgataagtcgcagcagaagctgtggcctgtcgaatttcaa
tggtcttattaa

DBGET integrated database retrieval system