KEGG   Shewanella loihica: Shew_1081Help
Entry
Shew_1081         CDS       T00489                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
slo  Shewanella loihica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shew_1081
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shew_1081
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shew_1081
Enzymes [BR:slo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shew_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1245127..1246410
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFTQAVKLGLGKDRGLFFPVSIPKLDNVDALLAMDFVERSKAVLGAW
LADELGQEMVDGLVERAFNFELPLTKADDRRFCLELFHGPTLAFKDFGARFMAQCLNSLA
QEDKLTILTATSGDTGAAVADAFYGLDKVQVVVLYPKGKISLLQEKMFTTLGDNIHTVAV
ESDFDACQDMVKAAFEDSDVRDGLHLNSANSINISRLLAQICYYFEAVAQFKQTNQGDPV
IAVPSGNFGNLTAGLFAKAMGLPVKRFVAATNSNDTVPRYLADGQWSPKATVATLSNAMD
VAEPSNWPRVETIMEVMNWPLSELVGVGLSEQDTVEALDELYCGGYLSEPHAAIAAKALS
LTMSADEQGIFLGTAHPAKFKEVVEQALAIELELPPELQAVKDKPILSAELPADFARLKA
HLFETLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactctataacttaaagcacccctcacagaaggttagtttcactcaggcggttaag
ctgggcctggggaaagatcgtggcttgtttttccctgtctctatccccaagttagataat
gtcgatgcgctgctggcgatggactttgtcgagcgttctaaggcggttttgggggcctgg
ttggcagacgaactgggtcaggagatggtggatggcctggtggagcgcgcctttaatttt
gagctgccgctgaccaaggccgatgacagacgtttctgcctggagctattccatggcccg
accctggcatttaaagacttcggcgcccgcttcatggcccagtgcctcaatagcctggcc
caggaagataaactcaccatattgaccgccacctcgggtgataccggcgccgccgttgcc
gatgccttctacgggctggataaggtgcaggtggtagtgctctatccaaagggcaagatc
agcctgctacaggagaagatgtttaccaccttgggcgataatattcataccgtggcggtg
gagagtgatttcgatgcctgtcaggatatggttaaggccgccttcgaagacagcgatgtg
cgtgacggcctgcatcttaactcggcaaactctatcaacatcagccgcttgctggcgcag
atctgctactacttcgaggcggtagcccagtttaaacagaccaatcaaggcgatcctgtg
atcgccgtgcccagcggtaatttcggcaacctgacggctggcctatttgccaaggcgatg
ggactgccggtgaagcgtttcgtggcggccaccaacagtaacgatactgtgccgcgctat
ctggccgatggtcagtggtcgcctaaggcaaccgtcgcgaccctctctaatgccatggac
gtggccgagccgagcaactggcccagggttgagaccatcatggaggtgatgaactggcca
ctgagcgaactggtgggcgttggtctctccgagcaagataccgtggaggcgttggatgag
ctctattgcggcggttatctatccgagcctcacgcggccatcgccgctaaggcgctgtcg
ttaaccatgtcggccgatgagcaggggatcttcctcggtacggcccatccggccaagttt
aaagaggtggtggagcaggcgctggctatcgagcttgagctgccgcctgagctacaagcg
gtgaaggataagcctatcctgtcggccgaactgcctgccgattttgcccgccttaaggct
cacctgtttgagaccttggcttag

DBGET integrated database retrieval system