KEGG   Shewanella loihica: Shew_1081Help
Entry
Shew_1081         CDS       T00489                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
slo  Shewanella loihica
Pathway
slo00260  Glycine, serine and threonine metabolism
slo00750  Vitamin B6 metabolism
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01230  Biosynthesis of amino acids
Module
slo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shew_1081
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shew_1081
Enzymes [BR:slo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shew_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABO22952
JGI: Shew1081
UniProt: A3QBV4
Position
1245127..1246410
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFTQAVKLGLGKDRGLFFPVSIPKLDNVDALLAMDFVERSKAVLGAW
LADELGQEMVDGLVERAFNFELPLTKADDRRFCLELFHGPTLAFKDFGARFMAQCLNSLA
QEDKLTILTATSGDTGAAVADAFYGLDKVQVVVLYPKGKISLLQEKMFTTLGDNIHTVAV
ESDFDACQDMVKAAFEDSDVRDGLHLNSANSINISRLLAQICYYFEAVAQFKQTNQGDPV
IAVPSGNFGNLTAGLFAKAMGLPVKRFVAATNSNDTVPRYLADGQWSPKATVATLSNAMD
VAEPSNWPRVETIMEVMNWPLSELVGVGLSEQDTVEALDELYCGGYLSEPHAAIAAKALS
LTMSADEQGIFLGTAHPAKFKEVVEQALAIELELPPELQAVKDKPILSAELPADFARLKA
HLFETLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactctataacttaaagcacccctcacagaaggttagtttcactcaggcggttaag
ctgggcctggggaaagatcgtggcttgtttttccctgtctctatccccaagttagataat
gtcgatgcgctgctggcgatggactttgtcgagcgttctaaggcggttttgggggcctgg
ttggcagacgaactgggtcaggagatggtggatggcctggtggagcgcgcctttaatttt
gagctgccgctgaccaaggccgatgacagacgtttctgcctggagctattccatggcccg
accctggcatttaaagacttcggcgcccgcttcatggcccagtgcctcaatagcctggcc
caggaagataaactcaccatattgaccgccacctcgggtgataccggcgccgccgttgcc
gatgccttctacgggctggataaggtgcaggtggtagtgctctatccaaagggcaagatc
agcctgctacaggagaagatgtttaccaccttgggcgataatattcataccgtggcggtg
gagagtgatttcgatgcctgtcaggatatggttaaggccgccttcgaagacagcgatgtg
cgtgacggcctgcatcttaactcggcaaactctatcaacatcagccgcttgctggcgcag
atctgctactacttcgaggcggtagcccagtttaaacagaccaatcaaggcgatcctgtg
atcgccgtgcccagcggtaatttcggcaacctgacggctggcctatttgccaaggcgatg
ggactgccggtgaagcgtttcgtggcggccaccaacagtaacgatactgtgccgcgctat
ctggccgatggtcagtggtcgcctaaggcaaccgtcgcgaccctctctaatgccatggac
gtggccgagccgagcaactggcccagggttgagaccatcatggaggtgatgaactggcca
ctgagcgaactggtgggcgttggtctctccgagcaagataccgtggaggcgttggatgag
ctctattgcggcggttatctatccgagcctcacgcggccatcgccgctaaggcgctgtcg
ttaaccatgtcggccgatgagcaggggatcttcctcggtacggcccatccggccaagttt
aaagaggtggtggagcaggcgctggctatcgagcttgagctgccgcctgagctacaagcg
gtgaaggataagcctatcctgtcggccgaactgcctgccgattttgcccgccttaaggct
cacctgtttgagaccttggcttag

DBGET integrated database retrieval system