KEGG   Shewanella loihica: Shew_1126Help
Entry
Shew_1126         CDS       T00489                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
slo  Shewanella loihica
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shew_1126
   00330 Arginine and proline metabolism
    Shew_1126
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Shew_1126
Enzymes [BR:slo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Shew_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1300465..1301379
Genome map
AA seq 304 aa AA seqDB search
MPQKDLLETIIEQVRPLLGKGKVADYIPALAEVDPTKLGIAVTTIDGQTIGAGDYLEPFS
IQSISKVFSLTVALTLYEEAEIWSRVGKEPSGQSFNSLVQIELERGVPRNPFINAGALII
ADLLQSRLGAPKHRMLEVVRKLSANPHVIYDKRVAASEYEHSARNAAIAYLMKSFGNFNN
DVDRVLRNYFHYCALKMSCADLSKAMLYLANRGQSLSAEQVVSPIQTRKLNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGDMSICVWSPELDKNGNSLAGTAALEKLSQALG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccacagaaggacctgctcgagactattatcgagcaggtgcgtcctctgctgggaaag
ggcaaggtcgccgactatattcctgccctggccgaggtggatcctaccaagcttgggatc
gccgtgaccacaatcgatggtcaaaccataggggctggagactatctcgagcccttttcg
atccagagtatctctaaggtctttagcctcacggtcgccctgaccctgtacgaggaggcc
gagatctggtctcgcgtcggtaaggagccctcggggcagtcctttaactccctggtgcag
atagagctcgagcgcggagtaccgagaaacccctttatcaacgccggcgcacttattatc
gccgatctgttgcagagtcgcctcggcgcgcctaagcatcgtatgctcgaggtggtcaga
aagctgagcgccaaccctcatgtgatttatgataagcgtgtcgcggcctctgaatatgag
cacagcgcccgtaacgctgccatcgcttacctgatgaagtccttcggcaactttaataac
gatgtcgatagggtgctgagaaactactttcactactgcgcgctgaagatgagctgcgcc
gatctatccaaagccatgctctatctggccaaccgaggccagagcctctcggcagagcag
gtggtttcgcccatacagacacgtaagcttaacgccctgttggcgacatctggtctgtac
gacggtgcgggtgagtttgcctatcgggtcggcatgccgggtaagagcggcgtgggcggc
ggcatcatagccgtgatcccgggcgatatgagcatctgtgtctggtcacccgagctagat
aaaaacggtaactctctagcgggcaccgccgcactcgagaagctctcccaagccctgggc
cgttctatcttctaa

DBGET integrated database retrieval system