KEGG   Shewanella loihica: Shew_1167Help
Entry
Shew_1167         CDS       T00489                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
slo  Shewanella loihica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shew_1167
Enzymes [BR:slo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Shew_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1343941..1346178
Genome map
AA seq 745 aa AA seqDB search
MGLEKLLYLQGVGASYSDYSGRLVHHSQAERLGLLACLLANCTQPKFHLDDLSPDGFVAA
NGEAIEERNFDLDVAPWQRPLATFQFACLTEPSFILSLPAEMQPDLRVRILTEGGTQLEM
SIPFAALERVGDYYCEPHLYYRYRVSIAPYLTQGQSLPMGYHKLSVGFCKGTLDGKSKLN
TVAIDWQTEGHHGTWLLAPPKAKQLRETDKPWGVSIALYSLRSDSQWGIGDFGDLGALIA
WLGGYGCDFIQLNPLHALGDSFNLEEAYISPYSPSDRRRLNPLYIHIESVPEANEIAPLL
QTLALDRERLNRDNWLDYPKLTQLKYRLFVALYQVFSRDVLGSGGPREQAFMQFVAQEGE
ALSSFCQLEADKAQAQGEQMAADPQLHSYLQFVAHEQLIACQHQALAAGMSIGLIGDMAV
GVRGDGAEVHHNRDAYCQQASIGAPPDDFAPKGQNWGLTPPDPIAMAQSGFSHFIALVRS
NMRYYGALRLDHVMALLRLWWWPSEPQEAPGAYVYYPIDTLLAIVRLESMRSNCVVIGED
LGIVPDEVRAKLSDGGIYANELFYFCKQGEAFKSPQDHRADSLMMLANHDVPTLLAWWSQ
SDLHLKRQLELLESDQALEQALERRDGERQQLLAWLEANGETASLEEDYLLLLSAWVTVA
ARSHSRLFSVQLADLCCERHGVNIPGTWQEYANWQRRLPYSLTSLRQSPSIKRLLRSIVE
GRSSAEASEQFCRAGEHLRQPVFSR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggcttagaaaagttactctatttgcagggcgtcggcgccagctatagcgattactcg
ggtcgcctggtgcaccatagccaggccgagcgcttagggcttctcgcttgtctgctggct
aactgcactcagcccaagtttcatctggatgatctcagcccagatggtttcgtcgccgcc
aatggtgaggcgattgaagaacgtaatttcgacctcgatgtcgcgccctggcaacgcccg
ttggcgacctttcaatttgcctgtctgactgagccaagctttatcttatcgctgccagcc
gagatgcagcccgaccttagggtgcgcatcctcaccgaaggcggcactcagctcgagatg
agtataccttttgcggcgctggagcgggtgggcgactattattgtgagccccacctctat
taccgctaccgggtatccatcgcgccttacctaactcagggccaatccctacccatgggc
tatcacaagctgtcggtgggtttctgtaaagggacccttgatggcaagagtaagctcaat
accgtggccatagactggcaaaccgaaggccatcacggcacctggctactggcgccgccc
aaggctaaacagctacgggagacggataagccctggggggtaagtattgccctctatagc
ctgcgcagcgacagtcagtggggcataggggactttggcgatctgggggctttgatcgcc
tggctcgggggctatggctgcgactttattcagctcaatccgctccatgccctgggggat
tccttcaatctggaagaggcctatatcagcccctacagtccgagcgacagacgcaggctc
aatcctctctatattcatatcgagtctgtgcccgaggccaatgagatagcgccgctgctg
caaactcttgccctggatcgcgagcgcctcaaccgtgataactggctcgattaccctaag
ctcacccagctcaagtatcgcctctttgtcgccctctatcaggtgtttagccgtgatgtg
ctgggtagcggtgggccgcgcgagcaggccttcatgcagtttgtcgcccaggaaggggag
gcgctgagcagtttctgccagctggaggcagacaaggcccaagctcagggagagcaaatg
gccgcagatccgcagttgcatagttacttgcagtttgttgcccacgagcagctgatcgcc
tgtcagcatcaggcgctcgcggcgggcatgagcattggccttatcggcgacatggccgtt
ggcgttcgcggcgatggcgccgaggtgcatcacaatcgagacgcctattgccagcaggcc
agcataggtgcgccgccggacgattttgcccccaaggggcagaactgggggctgacgccg
ccggatcctatcgccatggcccagtcgggctttagccattttattgcgctggttcgcagc
aacatgcgctactacggcgccctcagactcgatcatgtgatggcgctgctgcgtctctgg
tggtggccgagtgaaccccaggaggctcccggggcctatgtgtactaccccatagacacg
ctacttgcgatcgtgcgccttgagagcatgcgcagcaactgtgtggtgatcggcgaagat
ctcggcatagtgccggacgaggtgcgcgccaagctgagcgatggcggcatctatgccaac
gaactcttctatttctgcaagcagggcgaggcctttaagtcgccacaagatcacagggcc
gacagcctgatgatgctggctaaccatgacgtgcccacactactggcctggtggtctcag
agtgacctgcatcttaagcgtcagctggaacttctcgaaagtgaccaggcgctagagcaa
gccctagagcgacgcgacggcgagcgccagcagctgctggcctggctcgaagccaacggc
gaaaccgcctcgctggaggaagattatctgctcctgctcagcgcctgggtgacggtggcg
gcacgttcccactcgcgcctatttagtgtgcagctggcggatctctgctgcgagcgacac
ggggtcaacatccccggcacctggcaggaatatgccaactggcagcgacgactgccctat
agcctgaccagtctgagacagtcgccctcgataaagcgcctgctacgcagcatcgtcgag
ggacgcagctcggccgaggccagcgagcaattttgccgggcaggcgagcatcttcgtcag
cctgttttcagccgatga

DBGET integrated database retrieval system