KEGG   Shewanella loihica: Shew_1168Help
Entry
Shew_1168         CDS       T00489                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
slo  Shewanella loihica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shew_1168
Enzymes [BR:slo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Shew_1168
Exosome [BR:slo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shew_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1346226..1348523
Genome map
AA seq 765 aa AA seqDB search
MTKQIPVQTPAQTPLIAPSEIEALLAADYVDIFALLGMHAIEMAPATKSSKGIKEAKAVS
LVKRLVVRCFLPGAERVELIAKQDGRKVAELDKCHDEGIFAGLAGRRINPFEYRLRVHYP
FSVEEINDPYQYASLLSDEALYLFSEGRQEQAYRFMGANWREVDGVSGVQFCVWAPNAKR
VSLVHDAIDWDGRRQVMRHHPANGVWEIFIPSMKALTHYKYEIVTQEGERLLKADPFGRA
MQGAPGNASIVPPQLDYAWQDKRWLAKRAKQSWHDQPISIYEVHLGSWRRQGENGEQYLS
YSQLIDQLIPYVVEMGYTHLQLMPLCEYPFDGSWGYQPVGLFAPTHRFGQPHELKAFVDA
CHQAGIGVILDWVAAHFPKDPHGLTRFDGSCLYEHEDPRQGEHPDWDTLIYNYGRGEVQS
YLLSNAHYWLQEFHLDGLRLDAVSSMLYLDYSREPHQWLPNAHGGRENLDAIAFLQDLNT
RLYQGFPGIMMIAEESTAWPGVTKRVDEGGLGFGFKWNMGWMNDSLNYIGRDPIHRSHHH
NELTFSLMYCFTEQFILSLSHDEVVHGKGSLLHKIPGDDWQKFATLRAYLGFMWGHPGKK
LLFMGADFAQRDEWDHQHSLDWHLLAFEPHQGMQRWVKDLNSLYRQSVALYGDDHHGEGF
SWLDCDNASASVLSFIRQSGDKQLIFIVNMTPEVYREFRIGLPQPGRYHERLNSDSHYYG
GSDVGNQGVIHTEPEAYQGQAQSACISVPPLACLVLELDESVSCD
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcagataccagtgcagacacctgcgcagacaccactgatagcgccaagtgaa
attgaagccctgctggctgccgactacgtggatatcttcgccttgttggggatgcatgct
atagagatggctccggccactaagtctagtaagggcatcaaggaggctaaggcggtaagc
ctggtcaaacgcctggtggtgcgctgttttctgccgggggcagagcgggttgagctgatc
gccaagcaagatggccgcaaggtggccgagctggacaagtgccacgatgaggggatcttt
gccgggctcgccgggcggcgcatcaaccctttcgagtatcgcctgcgagtgcattatcct
ttcagcgtcgaggagataaacgacccttaccaatatgccagcctgctgagtgatgaggcg
ctgtacctcttcagcgaggggcgtcaggagcaggcctatcgtttcatgggggccaactgg
cgtgaggtcgatggggtgagcggcgtgcagttttgtgtctgggcgcccaatgccaagcgg
gtctctctggtgcacgatgccatcgactgggacggcagacgtcaggtgatgcgccaccat
ccggccaatggcgtgtgggagatcttcatcccctcgatgaaggcgctgacccactataaa
tatgagattgtcactcaggagggagagcgactgctcaaggccgatcccttcggccgcgcc
atgcagggcgccccgggtaacgcttcaatcgtaccgccccagctcgactatgcctggcag
gataagcgctggctggcgaaacgggccaagcagagctggcacgatcagcccatctccatc
tatgaggtgcatcttggatcctggcgtcgccagggggaaaacggcgagcagtatctcagc
tatagccagcttatcgatcagctgatcccctatgtggtcgagatgggctacacccatctg
caactgatgcccctgtgcgaatatcccttcgacggctcctggggctatcaaccggtcggc
ctgtttgcgccgacccacagattcggccagcctcacgagctcaaggccttcgtcgatgct
tgtcatcaggccggcataggggtgatcctcgactgggtcgcggcgcatttccccaaggat
ccccatggactgacccgcttcgacggctcctgtctctatgagcatgaggatccccgtcag
ggagagcatccagattgggatacccttatctacaactatggccgcggcgaggtgcagagc
tatctgctcagcaacgcccattactggctgcaggagtttcatttagatggcttgcgcctg
gacgccgtctcttccatgctttatctcgactacagccgcgagccccatcagtggctgcct
aacgcccatggcgggcgcgagaatctggatgccatcgccttcttgcaggacctcaacacg
cgtctctaccaaggctttcccggcatcatgatgatcgccgaagagtccaccgcctggccc
ggtgtcaccaagcgggtcgatgagggcggcctgggcttcggctttaagtggaatatgggc
tggatgaacgacagcctgaactatatcggccgggatcccatccatcgtagccatcatcat
aacgagctgaccttcagcctgatgtactgcttcaccgagcagttcatcctgtcgctgagc
catgacgaggtggtgcatggcaagggctccttgctgcataagatccccggcgacgactgg
cagaagtttgccaccctgcgggcctatctgggcttcatgtggggccatcccggtaagaag
ctgctcttcatgggcgcagattttgcccagcgcgacgagtgggatcatcagcatagcctc
gactggcacctactggcgttcgagccccaccaggggatgcagcgctgggtgaaagatctc
aacagcctctatcgtcagagcgttgccctctatggcgacgatcaccacggcgagggcttt
agttggcttgactgcgataacgccagcgccagcgtactgagttttatccgccagagcggc
gacaagcagctgatctttattgttaatatgaccccagaggtctaccgtgagtttcgcatc
ggtctgccgcagcccgggcgctaccatgagcgcctcaacagcgacagccactattatggc
ggcagcgacgtgggcaatcagggggttatccacaccgagcccgaggcctatcagggccaa
gctcagagtgcctgcatcagcgtgccgccgctggcctgtctggtgctggaactggacgag
agtgtgtcatgcgactga

DBGET integrated database retrieval system