KEGG   Shewanella loihica: Shew_1275Help
Entry
Shew_1275         CDS       T00489                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
slo  Shewanella loihica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shew_1275
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew_1275
   00630 Glyoxylate and dicarboxylate metabolism
    Shew_1275
Enzymes [BR:slo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Shew_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1474273..1475907
Genome map
AA seq 544 aa AA seqDB search
MTEQVMNKHQLETGLSILGAPVPGQEIVLNEGALSLLEVLCDQFAAEVPKLLEMRRQKQE
LIDKGSLPDFLPETRAIRDGDWQIRGIPQDLQDRRVEITGPVDRKMIINALNANVKVFMA
DFEDSLAPSWIKVIQGQINLRDAVRGEIEYTAPETGKHYTLDDDPAVLIARVRGLHLKEK
HVAFNGEAIPGALFDFCLYFYHNYRQLLEKGSGPYFYIPKLESHVEARWWAKVFAYVEER
FCLTPGTIKCTCLIETLPAVFEMEEILYELRSNIVALNCGRWDYIFSYIKTLKKHSDRIL
PDRQAVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDQAQNEAVLVKVRGDKEL
EARNGHDGTWVAHPGLADTAMGIFNEYIGEDHVNQLHITRDVDAPILARDLLMPCEGERT
ESGMRLNIRIALQYIEAWIRGNGCVPIYGLMEDAATAEISRTSIWQWIQHEQKLSNGKLV
TKALFKEMLVEELANVKLEVGPDRFTHGSFTQAAVLLEEITTADELVDFLTLPGYEILTQ
GDNA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggtaatgaataaacatcagctagagacgggattgtctatcctgggggcg
ccagtgccggggcaagagatagtgcttaacgaaggtgcgctgagtttgcttgaggtcttg
tgtgatcagtttgcggcagaggtacctaagctactcgagatgcgcaggcagaagcaggaa
ctgattgataagggctcgctgcccgatttcttacccgagacccgtgccatcagagacggc
gactggcagatccgcggtattccccaagacctgcaagacagacgcgtagagatcacaggg
cctgtggatcgcaagatgatcattaacgccctcaatgccaacgttaaagtctttatggcc
gacttcgaagactctctggcgcctagctggatcaaggtgattcaaggccaaattaatctg
cgtgatgccgtgcgcggcgagatagagtacacggcgcccgagacaggtaagcattatacg
ctcgatgatgatcctgccgtgcttatcgcccgtgtacgcggcctgcaccttaaagagaag
catgtcgccttcaatggcgaggcgatccctggggcactgtttgatttctgcctctacttc
taccacaactatcgccaattgctggagaagggcagcggaccttacttctatattcctaaa
ctcgagagtcatgtcgaggcgcgctggtgggccaaggtgtttgcctatgtcgaagagcgc
ttctgtctaacgccgggcaccattaagtgtacctgtcttatcgagacactaccggcggtg
ttcgagatggaggagatcctttatgagctgcgctctaacatagtcgcgctcaactgtggc
cgctgggactacatcttcagctacatcaagacgttgaagaagcatagcgaccgcatcttg
ccagaccgtcaggcggttaccatggataagccgttcctgagcgcctattcgcgtttgctt
atcaagacctgtcacaagcgtggcgccctggcgatgggaggcatggctgccttcattccg
gctaaggatcaggcgcagaacgaggcggtactggttaaggtgcgcggcgataaggagcta
gaggcgcgtaatggccatgacggcacctgggtggcacatccgggtctggccgacaccgct
atggggatcttcaacgaatacataggtgaagatcacgtcaaccagctgcatatcacccgt
gatgtcgatgcgccgattctggccagggatctcctgatgccctgcgaaggcgagcgcacc
gagtcgggcatgcgcctcaacattcgaattgcgctgcaatatatcgaggcctggatccgt
ggcaatggctgtgtgcccatctacggcttgatggaagatgccgccacggcagagatctca
cgtacctctatctggcagtggatccagcatgagcagaagctctctaacggcaagctggtc
accaaggcgctgttcaaggagatgctggtggaagagctggctaacgtcaaactcgaggtg
ggaccggatcgtttcacccatggcagctttacccaggccgccgtattgctggaagagatc
accacggccgacgagttggtggacttcctgaccctgccgggctacgagattttgacccag
ggcgataacgcctag

DBGET integrated database retrieval system