KEGG   Shewanella loihica: Shew_1275Help
Entry
Shew_1275         CDS       T00489                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
slo  Shewanella loihica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shew_1275
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew_1275
   00630 Glyoxylate and dicarboxylate metabolism
    Shew_1275
Enzymes [BR:slo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Shew_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1474273..1475907
Genome map
AA seq 544 aa AA seqDB search
MTEQVMNKHQLETGLSILGAPVPGQEIVLNEGALSLLEVLCDQFAAEVPKLLEMRRQKQE
LIDKGSLPDFLPETRAIRDGDWQIRGIPQDLQDRRVEITGPVDRKMIINALNANVKVFMA
DFEDSLAPSWIKVIQGQINLRDAVRGEIEYTAPETGKHYTLDDDPAVLIARVRGLHLKEK
HVAFNGEAIPGALFDFCLYFYHNYRQLLEKGSGPYFYIPKLESHVEARWWAKVFAYVEER
FCLTPGTIKCTCLIETLPAVFEMEEILYELRSNIVALNCGRWDYIFSYIKTLKKHSDRIL
PDRQAVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDQAQNEAVLVKVRGDKEL
EARNGHDGTWVAHPGLADTAMGIFNEYIGEDHVNQLHITRDVDAPILARDLLMPCEGERT
ESGMRLNIRIALQYIEAWIRGNGCVPIYGLMEDAATAEISRTSIWQWIQHEQKLSNGKLV
TKALFKEMLVEELANVKLEVGPDRFTHGSFTQAAVLLEEITTADELVDFLTLPGYEILTQ
GDNA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggtaatgaataaacatcagctagagacgggattgtctatcctgggggcg
ccagtgccggggcaagagatagtgcttaacgaaggtgcgctgagtttgcttgaggtcttg
tgtgatcagtttgcggcagaggtacctaagctactcgagatgcgcaggcagaagcaggaa
ctgattgataagggctcgctgcccgatttcttacccgagacccgtgccatcagagacggc
gactggcagatccgcggtattccccaagacctgcaagacagacgcgtagagatcacaggg
cctgtggatcgcaagatgatcattaacgccctcaatgccaacgttaaagtctttatggcc
gacttcgaagactctctggcgcctagctggatcaaggtgattcaaggccaaattaatctg
cgtgatgccgtgcgcggcgagatagagtacacggcgcccgagacaggtaagcattatacg
ctcgatgatgatcctgccgtgcttatcgcccgtgtacgcggcctgcaccttaaagagaag
catgtcgccttcaatggcgaggcgatccctggggcactgtttgatttctgcctctacttc
taccacaactatcgccaattgctggagaagggcagcggaccttacttctatattcctaaa
ctcgagagtcatgtcgaggcgcgctggtgggccaaggtgtttgcctatgtcgaagagcgc
ttctgtctaacgccgggcaccattaagtgtacctgtcttatcgagacactaccggcggtg
ttcgagatggaggagatcctttatgagctgcgctctaacatagtcgcgctcaactgtggc
cgctgggactacatcttcagctacatcaagacgttgaagaagcatagcgaccgcatcttg
ccagaccgtcaggcggttaccatggataagccgttcctgagcgcctattcgcgtttgctt
atcaagacctgtcacaagcgtggcgccctggcgatgggaggcatggctgccttcattccg
gctaaggatcaggcgcagaacgaggcggtactggttaaggtgcgcggcgataaggagcta
gaggcgcgtaatggccatgacggcacctgggtggcacatccgggtctggccgacaccgct
atggggatcttcaacgaatacataggtgaagatcacgtcaaccagctgcatatcacccgt
gatgtcgatgcgccgattctggccagggatctcctgatgccctgcgaaggcgagcgcacc
gagtcgggcatgcgcctcaacattcgaattgcgctgcaatatatcgaggcctggatccgt
ggcaatggctgtgtgcccatctacggcttgatggaagatgccgccacggcagagatctca
cgtacctctatctggcagtggatccagcatgagcagaagctctctaacggcaagctggtc
accaaggcgctgttcaaggagatgctggtggaagagctggctaacgtcaaactcgaggtg
ggaccggatcgtttcacccatggcagctttacccaggccgccgtattgctggaagagatc
accacggccgacgagttggtggacttcctgaccctgccgggctacgagattttgacccag
ggcgataacgcctag

DBGET integrated database retrieval system