KEGG   Shewanella loihica: Shew_1418Help
Entry
Shew_1418         CDS       T00489                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase GalU
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
slo  Shewanella loihica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Shew_1418
   00052 Galactose metabolism
    Shew_1418
   00500 Starch and sucrose metabolism
    Shew_1418
   00520 Amino sugar and nucleotide sugar metabolism
    Shew_1418
Enzymes [BR:slo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Shew_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1631972..1632892
Genome map
AA seq 306 aa AA seqDB search
MGGCLFYHIGFFMKVVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVNECVSAGVKE
IVLVTHASKNAIENHFDTSYELESTLEKRVKRQLLDEVQSICPKDVTIMHVRQGEAKGLG
HAVLCAKPCIGNNPFAVVLPDVILDEYSADQSSENLAAMIKHYKATQASQIMVAPVALDE
VNKYGIADCGGVNIEPGESSVIKAMVEKPAIDEAPSNLAVVGRYVLSEKIWDLLAKTPAG
AGDEIQLTDAIDMLIESDTVEAFNMTGKSHDCGDKLGYMAAFVEYGLRNEKLGKEFRQQL
DNLLAQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggggggttgtctgttttatcatattggattttttatgaaagttgttattcctgttgca
ggtcttggcacgcgcatgttgcctgcaaccaaagccataccgaaagagatgttgccgcta
gttgacaagccactcattcaatatattgttaacgagtgcgtatcagctggtgtgaaagag
attgtattggtaactcatgcgagtaagaatgctatcgagaaccattttgatacttcctat
gaacttgagtctacgcttgagaagcgtgtaaagcgtcagttactggacgaggtgcaatca
atttgccccaaagatgtgaccatcatgcacgtgcgccaaggcgaggctaaggggcttggt
catgccgtactttgtgctaaaccttgtattggcaataaccctttcgctgtcgtattgccg
gatgtgatcttagatgagtacagtgccgatcaaagctcagaaaaccttgcggcaatgatt
aaacattataaagcgactcaagctagccaaatcatggtagcgccagtggctctagatgaa
gttaacaagtacggaattgccgattgcggcggagtgaatatcgaacctggtgaatcatca
gttattaaggctatggttgaaaagcctgctattgatgaagccccgtctaatcttgctgtt
gtaggtcgttacgttttgtctgaaaaaatctgggacttgctggctaaaacccctgctggt
gcaggggatgaaatccaattgacagacgcaatcgacatgttgattgaatctgacactgtc
gaagccttcaatatgacaggtaagtctcacgattgtggcgacaagcttggttatatggca
gcctttgttgaatacggcctgcgtaatgaaaagctgggtaaagagtttcgtcagcagtta
gataacctgctagcacaataa

DBGET integrated database retrieval system