KEGG   Shewanella loihica: Shew_1626Help
Entry
Shew_1626         CDS       T00489                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
slo  Shewanella loihica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shew_1626
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Shew_1626
Enzymes [BR:slo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Shew_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1859477..1860478
Genome map
AA seq 333 aa AA seqDB search
MMDLLSTEMNAQEQAQLMHPMVGGLILFSRNYQDRDQLCALVASVRALRPDLLIAVDHEG
GRVQRFIDGFSKIPAMGDILPAAKQDLQLAKGWARELGFLMAVELLACDIDLSFAPVLDL
NGISQVIGTRAFSDKPDEVIALAEAFIQGMQDAGMAAVGKHFPGHGSVAADSHIAKPVDE
RSEAEIRALDMVPFAHLMGAKRLQGVMPAHVIYPKVDPNPAGFSSYWLKQVLREELKFDG
VIFSDDLGMKGAGVVGGYPERASAAIKAGCDMILLCNDSQGVSELLTSFEWPEQGPQVPA
RKLLANRPQVAKALEDESRYLAARRIAEQICMG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatggatttgttatccaccgagatgaatgcgcaggagcaagcgcagttgatgcatccc
atggtcggcgggctgatattgttttcccgcaactatcaagatcgcgatcagctctgcgcc
ttggtggcctcggtgcgtgcccttagacccgatctgcttatcgccgtggatcatgaaggc
gggcgggtacaaagatttatcgacggctttagtaagatccccgccatgggcgacatattg
ccagcggcaaagcaagaccttcaattagccaagggctgggcgagggagcttggttttctc
atggccgttgaattgctggcctgtgatatcgatttaagttttgcccctgtgctggatctg
aacggcatcagtcaggtgattggcacccgcgcctttagcgataagcccgatgaggtgata
gccctggccgaagcctttattcaagggatgcaggatgctggcatggccgccgtgggtaaa
catttccccggtcatggcagcgtggcggctgactcccatattgccaagccggtggatgag
cgtagcgaagccgagatccgcgccctggacatggtgccctttgcgcatcttatgggggcg
aagcgattacaaggggtgatgccggcccacgtgatctatcctaaggtcgaccccaatccc
gcgggtttctcctcctattggcttaagcaggtgctgcgtgaagagcttaagttcgatggg
gtgatcttctccgacgatctcggcatgaagggggctggcgtggtgggtggctacccagag
cgggccagcgccgctattaaggcgggctgtgacatgatcttgctgtgtaatgacagtcag
ggcgtcagcgagctgttaacctcgtttgagtggcctgagcaaggtccacaggtgccggcg
cgtaaactgctggccaacagacctcaggttgccaaggcgctggaggatgaatctcgttat
ctggcggcaagaaggatagcagagcagatctgtatgggctaa

DBGET integrated database retrieval system