KEGG   Shewanella loihica: Shew_1626Help
Entry
Shew_1626         CDS       T00489                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
slo  Shewanella loihica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:slo00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:slo00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1859477..1860478
Genome map
AA seq 333 aa AA seqDB search
MMDLLSTEMNAQEQAQLMHPMVGGLILFSRNYQDRDQLCALVASVRALRPDLLIAVDHEG
GRVQRFIDGFSKIPAMGDILPAAKQDLQLAKGWARELGFLMAVELLACDIDLSFAPVLDL
NGISQVIGTRAFSDKPDEVIALAEAFIQGMQDAGMAAVGKHFPGHGSVAADSHIAKPVDE
RSEAEIRALDMVPFAHLMGAKRLQGVMPAHVIYPKVDPNPAGFSSYWLKQVLREELKFDG
VIFSDDLGMKGAGVVGGYPERASAAIKAGCDMILLCNDSQGVSELLTSFEWPEQGPQVPA
RKLLANRPQVAKALEDESRYLAARRIAEQICMG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatggatttgttatccaccgagatgaatgcgcaggagcaagcgcagttgatgcatccc
atggtcggcgggctgatattgttttcccgcaactatcaagatcgcgatcagctctgcgcc
ttggtggcctcggtgcgtgcccttagacccgatctgcttatcgccgtggatcatgaaggc
gggcgggtacaaagatttatcgacggctttagtaagatccccgccatgggcgacatattg
ccagcggcaaagcaagaccttcaattagccaagggctgggcgagggagcttggttttctc
atggccgttgaattgctggcctgtgatatcgatttaagttttgcccctgtgctggatctg
aacggcatcagtcaggtgattggcacccgcgcctttagcgataagcccgatgaggtgata
gccctggccgaagcctttattcaagggatgcaggatgctggcatggccgccgtgggtaaa
catttccccggtcatggcagcgtggcggctgactcccatattgccaagccggtggatgag
cgtagcgaagccgagatccgcgccctggacatggtgccctttgcgcatcttatgggggcg
aagcgattacaaggggtgatgccggcccacgtgatctatcctaaggtcgaccccaatccc
gcgggtttctcctcctattggcttaagcaggtgctgcgtgaagagcttaagttcgatggg
gtgatcttctccgacgatctcggcatgaagggggctggcgtggtgggtggctacccagag
cgggccagcgccgctattaaggcgggctgtgacatgatcttgctgtgtaatgacagtcag
ggcgtcagcgagctgttaacctcgtttgagtggcctgagcaaggtccacaggtgccggcg
cgtaaactgctggccaacagacctcaggttgccaaggcgctggaggatgaatctcgttat
ctggcggcaagaaggatagcagagcagatctgtatgggctaa

DBGET integrated database retrieval system