KEGG   Shewanella loihica: Shew_1657Help
Entry
Shew_1657         CDS       T00489                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
slo  Shewanella loihica
Pathway
slo00020  Citrate cycle (TCA cycle)
slo00640  Propanoate metabolism
slo00660  C5-Branched dibasic acid metabolism
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
slo01200  Carbon metabolism
Module
slo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shew_1657
   00640 Propanoate metabolism
    Shew_1657
   00660 C5-Branched dibasic acid metabolism
    Shew_1657
Enzymes [BR:slo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Shew_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABO23524
JGI: Shew1657
UniProt: A3QDH6
Position
1906416..1907582
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALFAEYGLPVSEGYACDTPQEAVEAAGHIGGDMWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRATRR
VVFMASTEGGVEIETVAEETPELIHKAIIDPLTGPQPYQARDLGFKLGLNPTQMKQFTKV
FMGLATMFTDHDFALLEINPLVITTEGNIHCLDGKIGIDGNALFRQPKIRDMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDANVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVEVPVVVRLEGTNADLGREV
LANSGLDIIAAESLTDAAVKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaagccctatttgccgaatatggtttaccagtgtca
gaaggttatgcttgtgatacccctcaagaggcggtagaagcggctggccatattggcgga
gatatgtgggttgttaagtgtcaagtacacgcaggcggccgtggtaaagcaggtggcgtt
aaagttaccggcgataaagaagagatcagagcatttgctgagcattggttaggtaagaac
ctagtaacttatcagactgacgaaaaaggtcagccagttgctaagatcctagtcgaaagc
tgcactgatatcgcaaacgagctgtacctaggtgccgttgttgaccgtgcgacccgtcgc
gttgtcttcatggcgtctaccgaaggtggcgttgagattgaaacagttgccgaagagaca
cctgagctgatccacaaggcgattatcgatcctttgacaggtcctcagccttaccaggca
cgcgatcttggcttcaagttgggtctgaacccaactcagatgaagcagttcactaaagtc
ttcatgggtctggcgactatgttcaccgatcacgacttcgcactgcttgagatcaaccct
ctggttatcaccaccgaaggcaacatccactgtctagacggtaagattggtatcgatggc
aacgcactgttccgtcaaccaaagatccgtgacatgcacgatccatcacaggatgacgct
cgtgaagctcacgcggcgaaattcgagctgaactatgttgccctagacggtaacgtaggc
tgcatggtaaacggtgccggcctagcaatgggtactatggacatcgttaacctgcacggt
ggcaagccagctaacttcctggacgttggtggcggcgcgactaaagagcgtgttgctgaa
gcattcaagatcatcttgtctgacgctaacgtgaaagcggttctggttaacatcttcggt
ggtatcgtacgttgtgacatgatcgcagaaggtatcattggtgccgttaaagaagtgggt
gttgaagtgccagtggttgttcgtctagaaggtactaacgcagatctaggtcgcgaagta
ttggctaactctggtcttgacattattgcagccgagtcgctaaccgacgctgctgttaaa
gttgttgctgctgcggagggcaaataa

DBGET integrated database retrieval system