KEGG   Shewanella loihica: Shew_2040Help
Entry
Shew_2040         CDS       T00489                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
slo  Shewanella loihica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2354424..2355467)
Genome map
AA seq 347 aa AA seqDB search
MAKISMNLAKQLTETELSAKILRHAVPRMSELNIPVTPDNYAVWYEYFRGVNLDLKRAID
TLVASRAQFTAEVNAGLYNSFIREQSPEVIENVQIETQILINNFMTRLSEVTAGTAQFNL
SLTTFQQNISQDPDPKTLERLVDTLAEEVSQVVISNRQMEANLKTMNQEVAALKAEMEDL
NIAVMTDQLTSLRNRRAFDEEVLGHIQRFRREQRLSSLLLVDIDNFKQFNDTHGHLVGDK
VLAYIALALKQGVKGDDFVARYGGEEFVILLPDTEHSGAMVVAEQLRARIAERHLSIGKD
KKLSLGAITVSIGVATLRLDDDRESYLVRADEALYRAKSAGRNCVKG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatctctatgaatttggctaaacaacttaccgagaccgaactttccgctaaa
attctccgacatgccgttccgcgcatgtcagaactcaatatcccagtaaccccagataat
tatgccgtttggtatgagtatttccgtggggtcaatctggatcttaagcgcgccatcgac
accctggtggccagccgcgcccagtttaccgccgaggtcaatgccggcctctataacagc
ttcattcgcgagcagtcacccgaggtgatcgagaatgtgcagatagagacgcagatcttg
atcaataattttatgacccgtttatccgaggtcaccgcaggtacggcgcaatttaacctc
agcctgaccacctttcagcagaatatcagccaggacccagaccctaagaccctcgagcgc
ctggtcgataccctagccgaagaggtgtctcaggtggtgatcagcaatcgccagatggaa
gcgaatctgaagacgatgaatcaggaggtcgccgcgctgaaggcagagatggaagatctc
aatatcgccgtgatgacagatcagcttacctcgctgcgtaatcgccgcgccttcgatgag
gaggtgctgggtcatattcaaaggttcagaagagagcagcgccttagcagcttgctgctg
gtcgatatcgataactttaagcagtttaatgacacccacggtcacctggtgggcgataag
gtactcgcatatatcgcactggcgttaaagcaaggggtgaagggggatgactttgtcgcg
cgttacggcggcgaagagttcgtgatcctgctgccggataccgagcattcaggcgccatg
gtggtggccgagcaacttagggcgcgcatcgccgagcgccatctaagcataggcaaagat
aagaagctctcacttggggcgatcacagtctccataggggtggcgacactgcgccttgat
gatgacagagagtcttatctggtgcgcgccgatgaggccctatacagagccaagtcggca
ggccgcaactgtgtgaagggctaa

DBGET integrated database retrieval system