KEGG   Shewanella loihica: Shew_2076Help
Entry
Shew_2076         CDS       T00489                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
slo  Shewanella loihica
Pathway
slo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:slo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Shew_2076
Enzymes [BR:slo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Shew_2076
DNA repair and recombination proteins [BR:slo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Shew_2076
    RecFOR pathway proteins
     Shew_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH HHH_3 IMS_HHH 5_3_exonuc HHH_8
Motif
Other DBs
NCBI-ProteinID: ABO23942
JGI: Shew2076
UniProt: A3QEP4
Position
complement(2400643..2401260)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGLLVEKQAPEVLIETGGVGYEVQMPLTSFYELPELNQEAVIYTHFVVREDAQLL
YGFITKQERALFRLLIKTNGVGPKLALTILSGMTAGEFVKCVEHDDIATLVKLPGVGKKT
AERLLVEMRDKLKSLMEASHGNEREFVLQSNYTPAPVVNTAEEDAISALLALGYKPAQAS
KAVSSVFEEGMDSETLIKASLKSML
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgtttacggggattactcgtcgagaagcaggcgcccgaggtgctgattgaa
actggcggtgtcggctatgaggtgcagatgccgctcaccagtttttacgaattgccagaa
ttaaaccaagaggcggtgatctacacccacttcgtggtgcgtgaagatgcccagctgctg
tacggtttcatcaccaagcaggagagggcgctgttcaggctgctgatcaagaccaatggc
gtcggtcctaagctggcactgaccatactctctggcatgacggcgggcgaatttgtgaaa
tgcgtcgagcatgacgatatcgcaaccctggttaagctgccgggtgtcggcaagaagact
gcggagcgtctgttggttgagatgcgcgacaagcttaagagcctgatggaagcgtcccat
ggcaacgagcgcgagtttgtgttgcagtctaactatactcctgcgcctgtggttaacact
gccgaagaagatgccatctcggcgcttttggcgttaggatataagccggcacaggccagt
aaggcggtgtccagtgtcttcgaagagggcatggattcagaaaccttgatcaaggcatcg
ctgaaatcgatgctctag

DBGET integrated database retrieval system