KEGG   Shewanella loihica: Shew_2131Help
Entry
Shew_2131         CDS       T00489                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
slo  Shewanella loihica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:slo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Shew_2131
Enzymes [BR:slo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Shew_2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2476060..2478048
Genome map
AA seq 662 aa AA seqDB search
MIQLAQPLSQLLKHWQQEGLLTPLDRHFALQMQALHSDGDDLFTLICALLSRQLSQQHTC
LPLTQIDKNNPLHEQQPQCQLELTPQALAGQLTQYQAISPADGELNTPLILDGDRLYLQR
YYQFETQVAERLTRLNQPITVAAPDKVACILNILFAGQAEKPDWQKVATATAFSQKLAVI
TGGPGTGKTTTVTKLLLLLCLEQQLTIKLVAPTGKAAARLSESIKASKARLAQELAPYGD
ELDLEQLKQVPEEAATLHRLLGVIPGSHRFRHHKDNPLRLDLLILDEASMVDLPMMHKLL
EALPEHTRLILLGDQDQLASVEAGAVLADICAGLKQTSSQESGWRMRYSQEKAALLSQLT
NEDLSNYIDARPALGDSLAMLMHSHRFKGDAGIGQLAGAVNRRDLTGILSVWQKGYDELS
WLEHQLSPQGNAGLKALMAQSVDKYRPYLDLVGHLANKEQAQEVDKEADQQLDLDEIANQ
IITRFNNFRILCAMRAGEYGVEGINAAVTQALKDAQLIQPSSEFYAGRPIIIQSNDYNLG
LFNGDIGVILPGHGPTHRLMAYFVQADGSLLKVLPARLPSHETCYAMTVHKSQGSEFQQV
AFVLPPRPSVAQRQLLTKELVYTAITRAKGHFSCLGSQAVFEAACSQVTLRASGLAQRLW
PA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgatccagctagcacagccacttagccagctgcttaagcactggcagcaggagggactg
ctgaccccattggatcgccactttgccctgcagatgcaagccctgcacagcgatggcgac
gatctctttaccttgatctgcgccctgctcagccgtcaactatcccagcaacacacctgt
ctgcccctgacgcagatagacaagaataacccgctgcatgaacagcagccccaatgtcaa
cttgagctgaccccacaggcgctggccgggcagttgacgcaatatcaagccattagtccg
gccgatggtgagctaaacacccccttgatcctcgatggcgacaggctctacctgcagcgt
tactaccagtttgagactcaggtggccgagcgtctcacgcgcctcaatcagcccatcaca
gttgcggcgccagataaggtagcctgcatactgaatattctgtttgccggtcaggccgag
aagcccgattggcagaaggtagccaccgccaccgcctttagccagaagctggcggtgatc
accggcgggcccggtacgggcaagaccaccacagtaactaagctgttactgctgctctgt
ctggagcagcaactcaccatcaagttggtggcgccaacgggcaaggcggccgcgcgcctg
agcgagtcgatcaaggcctccaaggcgaggcttgcccaggagctggcgccctatggcgat
gagttagatcttgagcagcttaagcaggtgccagaagaggcagccaccctgcaccggcta
ctgggggtgatccccggctcccacagattcaggcaccacaaggacaatcctctcaggctg
gatctcttgatcctcgatgaggcctccatggtggatctgcccatgatgcacaagctgctg
gaagcgctgccggagcacaccaggcttattctgcttggcgatcaggaccagctcgcctcg
gtcgaggccggcgccgtgctggctgatatctgcgccgggctaaaacagacaagctcacag
gaaagtggctggcgcatgcgctactcacaagagaaggcagcactcctgagtcaactgacc
aatgaagatctcagcaactatatcgatgcgcgcccggcactgggcgatagtctggccatg
ctgatgcacagccacagatttaagggcgatgccggtatcggacaactagctggcgccgtc
aaccgccgcgatctgacgggcatattaagtgtctggcagaaaggatacgacgaacttagc
tggcttgagcatcaactctcgccccagggcaacgccggactcaaggccttgatggcacag
agcgtcgacaaatatcgcccttatcttgacttggttggtcacctggccaacaaagagcag
gctcaagaagtagataaagaggcagatcaacaactggatctggacgaaatcgccaaccag
atcatcactcgcttcaacaacttccgtatcctctgcgccatgcgcgccggcgaatatggc
gtcgaggggatcaatgcggcggtcacccaggcactgaaggatgcccagctgatccagcca
tccagcgaattttacgccggacgccctatcatcattcagagtaacgactataacctaggg
ctgtttaacggtgatatcggggttatcctgccaggtcatggccccacccaccgcctgatg
gcctatttcgttcaggccgatggcagcctgctcaaggtactgcccgctcgcctgcccagc
cacgagacctgttatgccatgacggtacataagagccagggcagtgagtttcagcaggtc
gccttcgtcttgccgccaaggcccagcgttgcccagcgccagctactgaccaaggagctg
gtctacaccgccatcacccgcgccaagggacactttagctgtcttggcagccaggcggtg
ttcgaagcggcatgcagtcaggtaacccttagggcctctggcctagcacagaggttgtgg
ccagcatga

DBGET integrated database retrieval system