KEGG   Shewanella loihica: Shew_2233Help
Entry
Shew_2233         CDS       T00489                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
slo  Shewanella loihica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:slo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2610691..2611290)
Genome map
AA seq 199 aa AA seqDB search
MKFSPLVDELIQSLRCLPGVGPKSAQRMAFQLLERDRKAGHKLAQALSSAMSDVGHCSSC
RTFTEESLCPICASSRRGNSDLICVVETPADVLAIEAGGHFSGRYFVLLGHLSPLDGVGP
DELGLSLLETHLASGEVSELILATNPTVEGDATAHFIADMAKQHEVNVSRIAHGVPVGGE
LEYVDSTTLALSFNGRIPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtcccctggtcgacgagttgatccagtcgctacgctgcctgcccggggtt
ggccccaaatcggcgcagcgcatggcgtttcaactgctagagcgcgatcgcaaggcgggt
cataagctggcccaggcgctgtcgagcgccatgagtgatgtggggcactgcagcagctgt
cgtaccttcaccgaagagagcctgtgtcctatctgcgccagtagtcgtcgtggtaactca
gatttgatctgtgtggtcgagacgcccgccgatgtattggcgatcgaagccggtggtcat
ttctcggggcgttattttgtgctcttagggcatctgtcaccgctcgatggtgtggggccg
gacgagctgggcttgagtctgctcgagactcacctggccagtggtgaggtaagcgaactt
atcctggccaccaacccgacggtagaaggggacgcgacagcgcactttatcgccgatatg
gccaagcagcatgaggtcaatgtgagccgaatcgctcatggtgtgcccgtgggcggcgag
ctggagtatgtcgacagcaccacgctggcgctctcctttaatggacgcattccgttataa

DBGET integrated database retrieval system