KEGG   Shewanella loihica: Shew_2255Help
Entry
Shew_2255         CDS       T00489                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
slo  Shewanella loihica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shew_2255
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shew_2255
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shew_2255
Enzymes [BR:slo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shew_2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2634863..2636074
Genome map
AA seq 403 aa AA seqDB search
MMTKLDPYFGEYGGMFVPQILMPALKQLEAAFVDAQNDPSFQAEFTDLLKNYAGRPTALT
LTRNLSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATA
LACALLGLKCKVYMGAKDVERQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSAS
YDKAHYLLGTAAGPHPFPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFIDEPSVKLIGVEPAGLGIDTPKHGAPLKHGKTGIFFGMKAPLMQDKEGQIEESYSI
SAGLDFPSVGPQHAHLAATGRATYESATDDEALAAFQLLARSEGIIPALESAHALAYAIK
LAEAATEETLLVVNLSGRGDKDIFTVADILEKQQANNEESGNE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaagctggacccttatttcggcgaatatggcggtatgtttgtaccgcagatt
ttgatgcccgccctcaagcagctcgaagccgccttcgtcgatgcgcagaacgatccgagc
tttcaagccgaatttaccgatctgctgaaaaactacgccggcagaccgaccgccttgacg
ttgacccgtaaccttagccctaaccctctggtgaagatctacctcaagcgtgaagatctg
ctccatggtggcgcccataagaccaaccaggtattgggtcaggccctgctggccaagcgt
atgggcaagaaagagatcatcgccgaaaccggcgccggacagcacggcgtcgccacggcc
ctggcctgcgcactattaggcctcaagtgtaaggtctacatgggcgccaaagatgtcgag
cgtcaatcgcccaacgtgttccgtatgcgcctgatgggcgccgaggtgatcccggtcacc
tcaggctcagccaccttgaaagatgcctgtaacgaggcgatgcgcgactggtctgccagt
tatgacaaggctcactacctgctaggcaccgccgccggtccacatcccttccccaccata
gtgcgcgaattccagcgcatgattggcgaagagaccaaggcgcagatcctagagcgtgag
ggtcgtctgcccgacgcggtgatcgcctgtgttggcggcggttcaaatgccatcggtatg
tttgccgactttatcgacgagccttcggtaaagcttatcggtgtcgagcccgcaggactc
ggcatagatacccctaaacatggcgcgccgctcaagcacggcaagacggggatcttcttc
ggcatgaaggcgccgctaatgcaagataaagagggccaaattgaggagtcttactccatc
tcggcaggcttggacttcccgtcagtggggccacagcacgcccatctggcggcgaccggt
cgcgccacctatgagtcggccacagatgacgaggccttagcggccttccagctgctggcc
cgcagcgaggggatcatcccggcactggagtcggcccatgccctagcctatgccatcaag
ctggccgaggccgctaccgaggagacgctattggtggtcaacctctcaggccgcggcgac
aaggatatcttcaccgtcgccgacatcttagaaaaacaacaagcaaacaacgaggagagc
ggcaatgagtaa

DBGET integrated database retrieval system