KEGG   Shewanella loihica: Shew_2256Help
Entry
Shew_2256         CDS       T00489                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
slo  Shewanella loihica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shew_2256
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shew_2256
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shew_2256
Enzymes [BR:slo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shew_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2636067..2636870
Genome map
AA seq 267 aa AA seqDB search
MSNRYQAAFAALNASGRGAFVPFVTIGDPNRELSLKIIETLVENGADALELGFPFSDPLA
DGPVIQGANLRALAAGTTPGGCFEIITAVRAKYPELPIGLLLYANLVYANGVEAFYAKAK
AAGVDSVLIADVPVEEAAPFIAAAKAHEVAPIFIAPPNGDAETLRQVAEQGQGYTYLLSR
AGVTGTESKAGMPLDDILAQLKAFDAPPPLLGFGIAEPDQVKAAIDSGAAGAISGSAVVK
IIETHQDDEQALLSALGQFTREMKAAT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgttatcaggcagcatttgccgcacttaacgcaagcgggcgtggcgccttc
gtgcctttcgtcaccataggcgatcccaacagagaattgtcgctgaagatcatcgagacc
ttagtagaaaacggcgccgatgccttggagctgggctttcccttctccgatcccctcgcc
gacggcccggtgatccagggcgctaacctgcgcgccttagccgcgggcactacgccgggt
ggctgtttcgagatcatcactgcggtgcgcgccaaatacccagagctgcccatcggcttg
ctgctgtacgccaacctagtgtatgccaacggcgtcgaagccttctacgccaaggccaag
gccgccggcgtggattctgtgcttatcgccgacgtgccagtggaagaggcagcgcccttt
atcgccgcagccaaggcccacgaggtagcgcctatctttatcgcgccgcccaatggcgat
gccgagacactgcgccaggtcgccgagcagggccagggctacacctacctactatcacgc
gccggcgtcacgggcacagagtcgaaggcaggcatgccgctggatgatatcctggcccag
ctcaaggccttcgacgcgccgccgcccctactgggctttggcatcgcagagccagatcag
gtcaaggccgccatcgactcgggcgcagcgggcgccatctcgggctctgccgtggtgaag
atcatcgagacccaccaagacgatgagcaggccctgctcagcgccctgggtcagtttacc
cgtgagatgaaggcggcaacctaa

DBGET integrated database retrieval system