KEGG   Shewanella loihica: Shew_2256Help
Entry
Shew_2256         CDS       T00489                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
slo  Shewanella loihica
Pathway
slo00260  Glycine, serine and threonine metabolism
slo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01130  Biosynthesis of antibiotics
slo01230  Biosynthesis of amino acids
Module
slo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shew_2256
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shew_2256
Enzymes [BR:slo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shew_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ABO24122
JGI: Shew2256
UniProt: A3QF74
Position
2636067..2636870
Genome map
AA seq 267 aa AA seqDB search
MSNRYQAAFAALNASGRGAFVPFVTIGDPNRELSLKIIETLVENGADALELGFPFSDPLA
DGPVIQGANLRALAAGTTPGGCFEIITAVRAKYPELPIGLLLYANLVYANGVEAFYAKAK
AAGVDSVLIADVPVEEAAPFIAAAKAHEVAPIFIAPPNGDAETLRQVAEQGQGYTYLLSR
AGVTGTESKAGMPLDDILAQLKAFDAPPPLLGFGIAEPDQVKAAIDSGAAGAISGSAVVK
IIETHQDDEQALLSALGQFTREMKAAT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgttatcaggcagcatttgccgcacttaacgcaagcgggcgtggcgccttc
gtgcctttcgtcaccataggcgatcccaacagagaattgtcgctgaagatcatcgagacc
ttagtagaaaacggcgccgatgccttggagctgggctttcccttctccgatcccctcgcc
gacggcccggtgatccagggcgctaacctgcgcgccttagccgcgggcactacgccgggt
ggctgtttcgagatcatcactgcggtgcgcgccaaatacccagagctgcccatcggcttg
ctgctgtacgccaacctagtgtatgccaacggcgtcgaagccttctacgccaaggccaag
gccgccggcgtggattctgtgcttatcgccgacgtgccagtggaagaggcagcgcccttt
atcgccgcagccaaggcccacgaggtagcgcctatctttatcgcgccgcccaatggcgat
gccgagacactgcgccaggtcgccgagcagggccagggctacacctacctactatcacgc
gccggcgtcacgggcacagagtcgaaggcaggcatgccgctggatgatatcctggcccag
ctcaaggccttcgacgcgccgccgcccctactgggctttggcatcgcagagccagatcag
gtcaaggccgccatcgactcgggcgcagcgggcgccatctcgggctctgccgtggtgaag
atcatcgagacccaccaagacgatgagcaggccctgctcagcgccctgggtcagtttacc
cgtgagatgaaggcggcaacctaa

DBGET integrated database retrieval system