KEGG   Shewanella loihica: Shew_2403Help
Entry
Shew_2403         CDS       T00489                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
slo  Shewanella loihica
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:slo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2818494..2819087
Genome map
AA seq 197 aa AA seqDB search
MQAACLLVFFLIPQAHANPILILGDSLSASYGMEQDKGWVHLLQQQSPEVTIINGSVSGE
TSAGGLRRLPALLDSTKAKRVFIELGGNDGLRGFSPKQLKNNLTKMILLAKDSGAEVLLS
EVMVPPNYGPRYAKQFTQVYQELSSEQGVTLVPFFMTEIAIHPELMQADGIHPNEQAQPQ
IVSFIRPWLIDTQQPSE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagccgcttgcctgcttgtcttcttcttgatcccccaggcccatgctaacccgata
ttgatcttaggtgatagcctaagcgcaagctacggcatggaacaagacaagggctgggtg
catctattgcagcaacaatcccccgaggtcaccatcatcaatggctcggtgagcggtgag
acctcggccggcggtctgcgccgactgcccgccctgcttgactcgaccaaggccaagcgg
gtctttatcgagcttggcggcaacgacggtctgcgcggattttcgcctaagcaattgaaa
aataatcttacaaaaatgatactgctcgccaaggactcaggcgccgaggtgctgctcagt
gaggtgatggtgccgcccaactatggcccgcgttacgccaaacaatttacccaggtctat
caggagctatcgagcgagcaaggggtcaccttggtgcccttcttcatgacagaaatagcc
attcatcccgagctgatgcaggccgacggcatacaccccaacgagcaggcacagccacag
atcgtcagctttatccgcccctggcttatcgatacgcagcaaccgagtgaatag

DBGET integrated database retrieval system