KEGG   Shewanella loihica: Shew_2403Help
Entry
Shew_2403         CDS       T00489                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
slo  Shewanella loihica
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Shew_2403
Enzymes [BR:slo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shew_2403
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Shew_2403
Lipid biosynthesis proteins [BR:slo01004]
 Fatty acid synthase
  Component type
   Shew_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2818494..2819087
Genome map
AA seq 197 aa AA seqDB search
MQAACLLVFFLIPQAHANPILILGDSLSASYGMEQDKGWVHLLQQQSPEVTIINGSVSGE
TSAGGLRRLPALLDSTKAKRVFIELGGNDGLRGFSPKQLKNNLTKMILLAKDSGAEVLLS
EVMVPPNYGPRYAKQFTQVYQELSSEQGVTLVPFFMTEIAIHPELMQADGIHPNEQAQPQ
IVSFIRPWLIDTQQPSE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagccgcttgcctgcttgtcttcttcttgatcccccaggcccatgctaacccgata
ttgatcttaggtgatagcctaagcgcaagctacggcatggaacaagacaagggctgggtg
catctattgcagcaacaatcccccgaggtcaccatcatcaatggctcggtgagcggtgag
acctcggccggcggtctgcgccgactgcccgccctgcttgactcgaccaaggccaagcgg
gtctttatcgagcttggcggcaacgacggtctgcgcggattttcgcctaagcaattgaaa
aataatcttacaaaaatgatactgctcgccaaggactcaggcgccgaggtgctgctcagt
gaggtgatggtgccgcccaactatggcccgcgttacgccaaacaatttacccaggtctat
caggagctatcgagcgagcaaggggtcaccttggtgcccttcttcatgacagaaatagcc
attcatcccgagctgatgcaggccgacggcatacaccccaacgagcaggcacagccacag
atcgtcagctttatccgcccctggcttatcgatacgcagcaaccgagtgaatag

DBGET integrated database retrieval system