KEGG   Shewanella loihica: Shew_2629Help
Entry
Shew_2629         CDS       T00489                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
slo  Shewanella loihica
Pathway
slo00900  Terpenoid backbone biosynthesis
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shew_2629
Enzymes [BR:slo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Shew_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABO24495
JGI: Shew2629
UniProt: A3QG97
Position
complement(3104289..3105476)
Genome map
AA seq 395 aa AA seqDB search
MQKMVILGATGSIGASTLSVIEQNPEAYKAFALVAHKSVDKMLDLCIKYNPSIAHMVDPQ
AAAELQRRLPAHMAIAVSSGEDELAAIVALPEVDCVMAAIVGAAGLPATLAAVKAGKRVL
LANKESLVMSGRLFIDAMQGSNAKVLPVDSEHNAIFQCLPEPAQQAIGACDLAGAGISHI
LLTGSGGPFLTSDLDSLSQMTPDQACKHPNWSMGRKISVDSASMMNKGLEYIEARWLFNA
TKEQLKVVVHPQSVIHSMVQYKDGSVLAQMGNPDMRTPIAHCMAYPQRISAGVEPLDFFK
VGQLSFLEPDFNRFPCLKLAIDACEQGQEATTVLNAANEVSVEAFLAGLIRFTDIARVNE
YCLSHVEQRSLDTIEDILALDGLARRAAQERVAKL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaatggtgattctaggcgccacaggttctatcggcgccagtaccctgagcgtt
atcgagcaaaatcctgaggcctacaaggcctttgccctggtcgcccataagagtgtcgat
aagatgctcgacttgtgtatcaagtacaatccatcgatagcccacatggtcgacccccag
gcggcagccgagttgcagcgtcgtttgccggcgcacatggctattgccgtctcttcgggc
gaagatgagttggcggctatcgttgctctgcccgaggtggattgcgtcatggcggccatc
gtcggcgcggcgggtctacctgccacactggcggcggttaaggcgggtaagcgggtgctg
ctggccaataaagagtcgctggtgatgtcgggtcgtctgtttatcgatgcgatgcagggc
tcaaacgccaaggtgttgccagtagacagtgagcacaacgccatcttccagtgtctgcca
gagcctgctcagcaagccattggcgcctgcgatctggccggtgccggcatctcccatatt
ttgttgaccggatcgggcggaccttttctcacctcagatctcgatagtctgagtcagatg
acgccggaccaggcctgcaaacatcctaactggtccatggggcgtaagatctcggtcgat
tccgccagtatgatgaacaagggactcgagtatatcgaggcccgttggctgtttaatgcc
accaaagagcaactcaaggtcgtagtgcatccccagagcgtgatccactctatggtgcag
tataaggacggcagcgtgttggcccagatgggcaatccagacatgcgcacgcccatagcg
cactgcatggcctatccgcaaagaatttcggcgggcgttgaacctttagattttttcaaa
gtcggacagttaagctttcttgaacccgacttcaatcgcttcccctgtctgaagttggcc
atagatgcctgcgagcagggacaggaagccaccacggtattgaacgcggccaacgaggtg
tcggtcgaggccttcctggcaggattgatacgttttaccgatatcgcacgggtaaacgag
tattgcctgagtcatgtcgagcagcgtagcttagacaccatagaagatattttggcgctg
gatggcctggcacggcgtgcggcgcaggagcgggtcgccaaactataa

DBGET integrated database retrieval system