KEGG   Shewanella loihica: Shew_2831Help
Entry
Shew_2831         CDS       T00489                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
slo  Shewanella loihica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shew_2831
   01230 Biosynthesis of amino acids
    Shew_2831
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shew_2831
   00051 Fructose and mannose metabolism
    Shew_2831
   00562 Inositol phosphate metabolism
    Shew_2831
Enzymes [BR:slo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shew_2831
Exosome [BR:slo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shew_2831
  Exosomal proteins of bladder cancer cells
   Shew_2831
  Exosomal proteins of melanoma cells
   Shew_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3355684..3356466)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGTAQLAQELFTKFATKLQNDSAEVVLCPPSIFLESVRQQLDANKE
ALNGCLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPYIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSTEFLSLCSIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactaagacgcccaatggtcgctggtaactggaaaatgaacggtactgcgcagcta
gcgcaagagttgtttaccaagtttgctaccaagcttcaaaatgattctgcggaagtggtc
ttgtgtccaccaagtatttttcttgaaagtgttcgtcagcaactcgatgctaacaaagaa
gcgttaaacggctgcttagttagaatgggtgcccaaaacctgagtcagcatgacttcggt
gcctatacaggcgaagtatctgggcagatgctgaaagattctggatgtcgctatgtgatt
attggtcactccgagcgtcgtagaatgtacggcgaaacaagcgacatcgtggcggaaaaa
tttgccgccgcacagaagcatggtttgacccctatcttatgtgtaggtgagtcgggtcca
gcacgtgaagcaagacgtaccttcgaggtgattgccgaagagctggatgtggtcatcgag
aagaatggcaccatggcttttgataatgcgattatcgcctatgagccactttgggccgta
gggacaggtaagagcgctacgccagagcaggcgcaggaagtacacgcgtttattcgcaag
cgtctctctgaagtgtctccgtatataggagagaatatcaggattttgtacggtggtagc
gtaacgccgagtaatgcagcagatctatttgctcaacctgatgtagatggtggactgata
ggcggtgctagcttaaactctaccgagtttttaagtttatgttcgatagcgatgagcgca
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system