KEGG   Shewanella loihica: Shew_3038Help
Entry
Shew_3038         CDS       T00489                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
slo  Shewanella loihica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shew_3038
Enzymes [BR:slo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Shew_3038
Peptidases [BR:slo01002]
 Cysteine Peptidases
  Family C44
   Shew_3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3608511..3610283
Genome map
AA seq 590 aa AA seqDB search
MCGIAGELSFTTSAKVDQVAAMLDKLAPRGPDGQGLYSLGPCCLGHRRLKIIDLSEHGAQ
PMVDAELGLTLVFNGCIYNYRALRAELSELGYHFFSHSDSEVILKAYAHWGRQCVEKFNG
MFAFAIHERDTGRLFIARDRLGIKPLYYFKDGHSLVFASSLPALLRHPVADTEIDPQSLN
HYLCFRAIVGDKTLFKQIHKLEAAHWMLVRPDGQVDHQSYWHLSPGSSLETETEETWSQQ
LEQKLFDSAKRRLEADVPVGVLLSGGLDSSLIVGLLHELGQKEIHTFSIGFDDVADEQGN
EFKYSDLIAEHYQTRHQKIVVSHSELISHLPDCVMAMSEPMVSHDVIGFYLLSKTVSQHV
KVVQSGQGADEVFGGYHWYPPMVDATAEDEAQTYQDAYFSWQYPEYQQLVAEPLLDGDHA
GDYVRRYFAHCPAETAIDKTLMLDTRVMLVDDPVKRVDNMTMAFGLEARVPFLDHELVEL
ASRIPFDLKLKEGGKYLLKQVARRIIPHQVIDRPKGYFPVPGLRNMQGPYLALAKEVFAR
PQARARGIFNMDYIDAMLASPEQQLTRFGSRLWQVTLLELWLQLHLDHES
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattgccggagaactctcttttaccactagcgccaaggtcgaccaagtcgcc
gccatgctggataaactggcgccaaggggaccagacggacagggcctctatagcctagga
ccatgctgtctgggccacaggcgactaaagatcatcgacctgagtgaacatggcgcccag
cctatggtcgacgccgaactcgggcttaccctggtattcaacggctgtatctacaactac
cgcgcattacgggccgaactgtctgagttgggctaccactttttctcccacagcgacagc
gaggtaatactcaaggcctatgcccattggggtcgccaatgtgtcgaaaaattcaatggc
atgtttgcctttgccattcatgagcgtgatacaggacggctctttatcgccagagacagg
ttgggcatcaagcctctctactacttcaaagatggccacagtctggtatttgcctccagc
ttacccgccctcttgcgtcatccggtcgccgatacagagatagacccccagtctctcaac
cactatctctgttttcgcgccatcgtcggcgacaaaaccttgtttaagcagatccataaa
ctcgaggcggcacattggatgctggtgagacccgacggccaggttgaccaccagtcctac
tggcacctctcaccaggctctagccttgagacggaaaccgaggagacctggtctcaacaa
ctggaacagaagctgtttgacagcgccaagcgccgtttagaagccgacgtacctgttgga
gtgctcctctccggcggcttagattcatcattgatcgtgggcttgttgcacgagctgggt
caaaaagagatccataccttctctatcggctttgatgatgtcgcagacgagcaaggtaat
gaattcaaatactcagatctgatcgccgagcattaccagactcgacatcaaaagatagtg
gtcagtcatagtgagcttatctctcatctgcccgactgcgtgatggcgatgtctgagccc
atggtgtctcacgatgtcatcggcttctatctgctctctaaaactgttagtcaacacgtc
aaggtggttcagagtggccaaggggccgatgaggtctttggcggttatcactggtatcct
cctatggtcgacgccaccgcggaagatgaggcacaaacctatcaagacgcctacttctcc
tggcaatatccagaataccagcagctggtcgccgagccgctcctcgatggcgatcatgca
ggcgattacgtacggcgctacttcgcccattgcccggccgaaactgccatcgacaagacc
ctgatgttggatactcgggtgatgttagtcgacgacccggttaagcgggtcgataacatg
accatggccttcgggctcgaagccagagttcccttcttagaccatgagctggtcgaactg
gccagtcgcatccccttcgatctcaagctcaaggagggcggcaaatacctactcaaacag
gtcgccagacgcatcatcccccatcaggtaatagacagacctaagggctactttcctgtg
cccgggctgcgtaacatgcaggggccttacctggctctcgctaaagaggtctttgcccgt
ccacaggccagagcaaggggaatcttcaatatggactatatcgacgccatgctcgctagc
cctgagcaacaactcactcgcttcggctcacgtctgtggcaggtgacactcttagaactc
tggctgcagcttcatctagaccatgaaagctag

DBGET integrated database retrieval system