KEGG   Shewanella loihica: Shew_3226Help
Entry
Shew_3226         CDS       T00489                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
slo  Shewanella loihica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shew_3226
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Shew_3226
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shew_3226
Enzymes [BR:slo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Shew_3226
Exosome [BR:slo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shew_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3849051..3850682
Genome map
AA seq 543 aa AA seqDB search
MKLTRLCSLLCLGAALVSGSLWADNLLGPQTAPSRPKNIVIMVGDGMGPAYTSAYRYYQD
NPNTQEIEQTVFDRLLVGNASTYPAPVSGYVTDSAAAATALATGVKTYNGAVSVDIDKRP
VPTLLELAKKRGMSTGVTVTSQINHATPAAFLSHNESRRNYEALAQSYLSTDADVMLGGG
QKYFSDKLIKQFEAKGYRVLKDSALLEGVTQPKVMGLFADVQLPWAIDEPEARRLSTMTA
KALELLSQNDQGFVLLVEGSLIDWAGHNNDIATAMAEMHEFASAIEVVEQYVRQHQDTLL
VVTADHNTGGLSIGKQGEYRWDSQMLRQISASPTQIAKQALALDEWRSGVSGALGFTPSD
DEFSALDNARMQGEQVLTTQLKKLIDQRSNTGWTTGGHTGVDVQVFAAGPASSLFAGHQD
NTDIAHKLISLLPKAAKAKPEAKQAPAKPLEPKAAKPVEAEPEAAPQETEVKVEVESKAK
DLIDSQVLPKEDVKPAAEGQSAASDSNAKKMDAKQTLQQAEDLLSEGAESQSAAPVSQVD
NQD
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaacccgcttatgttccctcctctgcctgggtgccgcgctggtatcgggcagc
ctctgggccgacaacctgctcggcccgcagacggcgccgagtcgtcccaagaatatcgtt
atcatggtgggcgatggcatgggccctgcctacaccagcgcctatcgctactatcaggac
aaccccaacacccaggagatagagcagacggtatttgaccgcctcttggtgggcaacgcc
agcacctatcctgcgcccgtcagcggctatgtcaccgactcggcggcggccgccaccgcc
ctggccacaggggtgaagacctataacggcgccgtgtcggtagatatcgataagcgccct
gtccccaccctgctggagctggccaagaaacgcggcatgagcacaggcgtgacagtgacc
agccagatcaaccacgccaccccggccgccttcttgagtcacaacgagagccgccgtaac
tatgaggctctggcccagagctacctgagcacagatgccgacgtcatgctcggcggcggt
cagaaatatttttctgacaagctgatcaagcagttcgaggccaaggggtatcgggtactc
aaggattcagccctgctggagggtgtaacccaacctaaggtgatgggtctgttcgccgac
gtacagcttccctgggcgatcgatgagccggaggccagacgcctgagcaccatgaccgcc
aaggcgctggaactactctcccagaacgaccaaggcttcgtgcttctggtagaaggcagc
ctgatcgactgggccggtcacaacaacgatatcgccaccgccatggccgagatgcatgaa
tttgccagcgccatcgaggtggtcgagcagtatgtgcgtcagcatcaagatactctctta
gtcgtcaccgccgaccataacaccggcggtctctcaatcggcaaacaaggcgagtaccgc
tgggacagccagatgctgcgccagataagcgccagcccgacacaaatcgctaagcaggca
ttggccctggacgagtggcgaagcggcgtgagcggcgccctaggttttaccccgagcgat
gacgagtttagcgcactggataacgccagaatgcagggcgagcaggtgctgaccacccag
cttaagaagctaattgaccagcgctccaacacaggctggaccacgggcggtcatacggga
gtggacgtgcaggtgtttgctgccggcccggcctcatctctgtttgccggccatcaggac
aatacggatatcgcccataagctgatcagtctgctacctaaagcggctaaagctaagcca
gaagctaaacaggctcctgctaagcctctagaacctaaggcggctaagcctgtagaagct
gagcctgaagcggcgccgcaggagactgaggtgaaagttgaggttgagagcaaggccaag
gatctcatcgactcacaggtattgccgaaagaagatgtgaaaccggctgccgagggacag
tctgccgccagcgactctaacgctaagaagatggacgccaagcagacgctacagcaagca
gaagatctgcttagcgagggcgccgagagtcagtccgccgcccccgtgtctcaggtagac
aatcaagactaa

DBGET integrated database retrieval system