KEGG   Shewanella loihica: Shew_3269Help
Entry
Shew_3269         CDS       T00489                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
slo  Shewanella loihica
Pathway
slo00052  Galactose metabolism
slo00511  Other glycan degradation
slo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Shew_3269
  Lipid metabolism
   00600 Sphingolipid metabolism
    Shew_3269
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Shew_3269
Enzymes [BR:slo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Shew_3269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N Glyco_hydro_2 DUF4981 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ABO25135
JGI: Shew3269
UniProt: A3QI37
Position
3908831..3912061
Genome map
AA seq 1076 aa AA seqDB search
MINRFSLLQRLSYTLAFSLVFGLVVSNPALARDRWQDHTLFEVNKLAPHASFFGYESEPL
ALLDEMDRSQLYLDLNGRWRFHLAKNPDATPKEFAAPEFDASHWGSIQVPGNFETQGYGH
AIYLDERYPFDTKWPDAPSDHNPTGLYRKTFTLPAHWQQKQVFIHIGAARSALTLFVNGR
EVGYSQGAKTPAEFDITPYLQAGDNLVAMQLIRWSDASYLESQDMLRMTGIEREVYLYAT
PKQRIEDIQVVTHLNEDLTRAKLAIRVDIASHQPGVRALELEARLLDPQGKPVAKANQRL
SLKGDAKPVFSQTLISPKLWNAEMPNLYRLILTLKTEKGETLQVASQQIGVRKIAIENGQ
LKVNNKAITIRGVDRHETDPQTGHVVSRETMELDIRLMKQNNINAVRSSHYPNHPYWLSL
ADRYGLYVIDEANIESHPLAIDDKTQLGNEMSWLPAHQARIERMVERDKNHPSVIIWSLG
NEAGEGKLFERLYQWIKRRDPNRPVQYEPAGEAPYTDIVAPMYPSIERIREYAERASDRP
LIMIEYAHAMGNSVGNLQDYWDVIEAYPQLQGGFIWDWVDQALAFSNDLGQRYWAYGKDY
HPDMPTDGNFLNNGLVDPDRNPHPHLSEVKKVYQPIKLRDFKVEGDKASVNLINGFDFAS
TSGLSLNWTLQKDGKIIASKRQAMPILSPGEQARVSLTLPGKQSLSAPFEYHLLLEVLVD
TPRPLLPSDLRIAFEQFALPRFGTKAAYQVKKNQAKISEDSGSYRLTSGELSYEFDKRSG
WLTQIYQEGEPQLKAPLMANFWRAPTDNDLGNQMPDWAGAWQDAATELEVTAIDADLALG
LTISQTHAEKGFSLRTRYSLDNAGRLMVDSQFIPGNKPLADLPRFGFSTRLGFEHRYLSY
FGRGPEETYADRQSGNPLGWYALPIEQTYHRYPRPQETGQRTQVRYAAVTDQRGQGWLAI
ANQAHAGEQDRKEADEVATLQTSLWPFAQADIDFRRGDAQDSASGLVAVTRNHGAEIPLR
EFVTWNIDYRQMGVGGDTSWGRPVHGPYRIKAEPIRFGFTLMPVSSDDDIRTLARQ
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaccgcttctctctgctacagagactctcctatacacttgcattctctctagtc
tttgggctggtagtctccaacccggcgctggcaagggatcgctggcaggatcacacccta
ttcgaggtcaacaaactggcgccccatgccagcttcttcggttatgaatcagagcctctg
gcgctgctcgacgagatggaccgtagccagctttatctggatctcaacggccgctggcgc
tttcatctagccaagaatcccgatgccacccccaaagagttcgccgctcccgagtttgat
gccagccactggggtagcatacaggtgccgggcaatttcgagacccagggctacggccac
gccatctacctcgacgagcgctatcccttcgacacgaagtggcccgatgcgccgagcgat
cacaaccccacaggcctctaccgcaagacctttaccctgcccgcccattggcagcaaaaa
caggtgtttatccacataggcgcggcgcgctcggccctcaccctgttcgtcaatggccgt
gaggtcggctatagccagggcgccaagaccccggctgagttcgacattaccccctacctg
caagcgggcgacaatctagtcgccatgcagttgatccgctggagcgacgccagttacctg
gaaagccaggatatgctgcgcatgacagggatagagcgcgaggtctacctctatgccacc
cccaagcagcgcatagaagatattcaggttgtcactcatctaaacgaggatctcacccgc
gccaagctcgccatcagggtcgatatcgccagccaccagccaggggtaagagcccttgaa
ttggaggcgcgcctgctggatccccagggcaagccggtcgcgaaagctaaccaacgcctg
agcctgaaaggcgatgccaagcccgtctttagccagaccctaatatcccccaagctgtgg
aacgccgagatgccgaatctgtaccggctcatcctgaccctcaagacagaaaaaggagag
acgcttcaggtcgccagtcagcagataggcgtgcgcaagatcgccatcgaaaacggccag
cttaaggtcaacaacaaggcgatcaccatacgcggcgtggatcgtcacgagacagatccc
caaaccggccatgtggtcagccgagaaaccatggagctggatatccgcttgatgaagcaa
aacaatatcaatgcggtgcgctccagccactaccccaatcatccctactggctcagcctc
gccgaccgctatggcctgtatgtgatcgatgaggccaatatagagtcccacccgctggcg
atagacgacaagacccagctgggcaacgagatgagctggctgcccgcccatcaggcgcgc
atcgagcgtatggtcgagcgcgacaagaaccacccctcggtgatcatctggtctctgggt
aacgaggccggtgaaggcaagctgtttgagcgcctctatcagtggataaaacggcgggat
cccaatcgacctgtgcagtatgaaccggcgggcgaggcgccttacacggatatcgtcgcc
cccatgtatccctccatcgagcggatacgcgaatatgccgagcgtgccagcgaccgaccg
ctgatcatgatcgaatacgcccacgccatgggcaactcggtaggcaacctgcaagactac
tgggatgtgatagaggcctatccccagctgcagggcggcttcatctgggactgggtggat
caggcgctggccttcagcaacgatttaggtcagaggtactgggcctacggcaaggactat
caccccgatatgcccacagacggcaacttcctcaacaacggcctggtggatcccgaccgt
aacccccatccccacctgagtgaggtgaaaaaggtctatcaacccatcaagttgagagac
tttaaggttgagggtgataaggcctcagtgaatctcatcaacggcttcgacttcgcctcc
acctcaggcctgagcctgaactggacgctacaaaaagatggcaagatcatcgccagcaag
cgccaggccatgccgatactctcccccggcgagcaggcccgtgtcagcctcaccctgccg
ggcaaacagagcctcagcgcccccttcgagtatcacctgctactcgaggtactggtcgat
acccctagacccctgctgccgagcgatctccgcatcgccttcgagcagttcgccctgccg
cgcttcgggactaaagccgcttatcaagtaaagaaaaaccaggccaagatcagcgaagat
agcggcagctatcgcctcacctcgggtgagctgagctatgagtttgacaaacgcagcggc
tggctgacccagatctaccaagagggagagccccagcttaaggcgccactgatggccaac
ttctggcgcgcgccaaccgacaacgacctgggtaaccagatgccggattgggcaggggcc
tggcaagacgcggcaacggagctagaagtcacggcaatcgacgccgacctagcccttggc
ctgaccatcagccagacccatgccgagaagggctttagcctgcgcacccgctatagcctg
gataatgccggacgcctgatggtcgacagccagtttatccctgggaataagccgcttgcc
gatctgccccgcttcggcttcagcaccaggctaggctttgagcacagatacctgagttac
tttggccgcggcccagaggagacctacgccgatcgccagtcgggcaatcccctgggctgg
tacgccctaccgatagagcaaacctatcacagatacccaagaccccaggagactgggcag
cgcactcaggtgcgctacgccgcggtgacagatcaaaggggtcaaggttggctggcgatc
gctaaccaggctcacgcaggagaacaggacagaaaggaggcagatgaggtcgccacccta
cagaccagcctctggcccttcgcccaggccgacatagattttcgccgcggcgatgcccag
gactcggcctcgggtctggtggccgtcacccgcaaccacggcgccgagatcccgctaagg
gagttcgtcacctggaacatcgattaccgccagatgggcgtcggcggtgatacctcctgg
ggccgtcctgtgcacgggccctaccgcatcaaggccgagccgatccgcttcggctttacc
ctgatgccagtgagcagcgatgacgatatccgcaccctggcaagacaataa

DBGET integrated database retrieval system