KEGG   Shewanella loihica: Shew_3400Help
Entry
Shew_3400         CDS       T00489                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
slo  Shewanella loihica
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:slo00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4048986..4050872
Genome map
AA seq 628 aa AA seqDB search
MQDKNNKPANQLENAGRREFMGKTALLGAGAVAAPMSAAMFASMAKAQAAEASNSPVVHP
GELDEYYGFWSGGHSGEVRIMGLPSMRELMRIPVFNIDSATGWGITNESKAVKGESAHLM
AGDAHHPHMSMQDGRYDGKYLFINDKANTRVARIRCDVMKTDKMITIPNAQAIHGLRVQK
VPYTKYVICNGEFEVPLNNNGKETLEDVSTYRSLFNVIDAEKMEVAFQVMVDGNLDNTDA
DYDGKYFASTCYNSEMGMNLSEMITAERDHVVIFNLARCEAAVKAGKFKTYNGNKIPVLD
GRKGSDLTRYIPVPKSPHGLNTSPSGKYFVANGKLSPTVSIISIEKLDDLFDDKIKPRDA
IVGEPELGLGPLHTAFDNKGYAYTTLFLDSQIAKWNVEEAIQAYQGKKVNYLRQKLDVHY
QPGHNHTSQGETRDADGKWLVSLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPT
FAEPHDCIIVHRSKLKPKKLWTRDDPLFADTVAMAEKDGVRLMMDNKVIRDGNKVRVYMT
SVAPNYGMSEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEIGPQATASVTFIAD
KPGVQWYYCNWFCHALHMEMRGRMLVEA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataagaataacaaaccagccaaccagttggagaacgctggtcgacgcgagttt
atgggcaagacggccctgctgggggcgggtgcagtggccgcccccatgagcgccgccatg
ttcgcctcgatggccaaggcccaggcggccgaggccagtaacagcccagtggttcatcca
ggggagctggacgaatactatggtttctggagcggtggacactctggcgaagtccgtatc
atgggcctgccctcgatgcgagagctgatgcgtatcccggtattcaacatcgacagcgcc
accggctggggcatcaccaacgagagtaaggcggtcaagggcgaaagcgcccacctgatg
gctggcgacgcccaccacccacacatgagcatgcaggacggccgctacgacggtaaatat
ctcttcatcaacgacaaggccaacacccgcgtggcccgtatccgttgtgacgtgatgaag
acagataagatgatcaccatccccaacgcccaggccatccacggcctgcgggtacagaag
gtgccttacactaaatatgtcatctgtaacggcgaattcgaggtcccgctgaacaacaat
ggtaaggagacgctggaagatgtcagcacctatcgctccctgttcaacgtgatcgatgcc
gagaagatggaggtcgccttccaggtgatggtagacggtaacctggataacacagatgcc
gactacgacggcaagtacttcgcctctacctgctacaactcagagatggggatgaatctc
agcgagatgatcaccgccgagcgcgaccatgtggtgatcttcaacctggcccgctgtgag
gccgcggtcaaggccggtaagtttaagacctacaatggcaacaagatccccgtgctggat
ggtcgcaagggctcagatctcacccgttatattcccgttcctaagtcgccacacggcctg
aacacctcgccaagcggcaagtacttcgtcgccaacggcaagctatcaccgaccgtctct
atcatctctatcgaaaaactggacgacctgttcgacgacaagatcaagccaagagacgcc
atcgtcggtgagccagagctgggccttggcccgctacacactgcgtttgacaacaagggc
tacgcctacaccaccctcttcctcgacagccagatcgccaagtggaacgtggaagaggcg
attcaggcctaccagggcaagaaggtcaactacctgcgccagaagctggacgtacactat
caaccgggccacaaccacacctctcagggcgaaactcgcgatgccgatggcaagtggttg
gtgtctctgtgtaagttctccaaggacagattcctgcccgttggcccgttgcgcccagag
aacgatcagctgatcgacatctcaggcgatgagatgaagctggtgcacgacggcccaacc
ttcgccgagcctcacgactgcatcatagtgcaccgtagcaagctcaagccgaagaagctg
tggacccgagacgatccgctgtttgccgatactgtggccatggccgagaaagatggcgtg
cgcctgatgatggacaacaaggtgatccgcgacggcaacaaggtccgtgtctacatgacc
tcggtcgcgcccaactacggcatgagcgagtttaaagtcaagctgggcgacgaggttacc
gtagtggtcaccaacctggatcaggtggaagacgtgacccacggcttctgtatgaccaac
catggcgtacagatggagattggcccacaggccacggcatctgtcaccttcatcgccgac
aagcctggggtacagtggtactactgcaactggttctgtcacgccctgcacatggagatg
cgtggccgcatgttggtagaagcctaa

DBGET integrated database retrieval system