KEGG   Shewanella loihica: Shew_3430Help
Entry
Shew_3430         CDS       T00489                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
slo  Shewanella loihica
Pathway
slo00010  Glycolysis / Gluconeogenesis
slo00020  Citrate cycle (TCA cycle)
slo00620  Pyruvate metabolism
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
slo01200  Carbon metabolism
Module
slo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shew_3430
   00020 Citrate cycle (TCA cycle)
    Shew_3430
   00620 Pyruvate metabolism
    Shew_3430
Enzymes [BR:slo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Shew_3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N Peptidase_M23 HlyD_D23 HlyD_3 PYNP_C DUF2118 NQRA
Motif
Other DBs
NCBI-ProteinID: ABO25296
JGI: Shew3430
UniProt: A3QIJ8
Position
complement(4093917..4095869)
Genome map
AA seq 650 aa AA seqDB search
MAELKEVLVPDIGGDEVQVIEICAAVGDTLAAEESIITVESDKATMDIPAPFAGKLAEIK
VAVGDTVSEGTLIAMMEAGEAQAAEPAPAESAPVAAPAAPAPAAPVASAPASAQVIEVTV
PDIGDASDVDVIEVLVAVGDSINVDTGLITLETDKATMEVPAPAAGVVKEMKVAVGDKVS
QGSLVLMLEVSGGEAAAPAASAAPAPSAEAAPAAAASIEVKEISVPDIGDASDVDVIEVL
VAAGDVIEADQGLITLETDKATMEVPAPFAGKLVSVTVKVGDKVSQGSVIATIETQSSAP
VAAPAPAAAAPAPVAQASAPAPAASKPPVPHHPSAGSKPVTGAVHASPAVRRLAREFGAD
LTQVTGTGPKGRILKEDVQAFIKYELSRPKASAATSVGAGEGGLQVIAAPKVDFAKFGEV
EEVPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEAFRKQQNEIAAKQKTGVKITPL
VFMMKAVAKTLQQFPVFNASLSADGESLIKKKYYHIGVAVDTPNGLVVPVVRDVDKKGII
ELSAELMEISVKARDGKLKAADMQGSCFTISSLGGIGGTAFTPIVNYPDVAILGVSKSEI
KPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSSMLSDIRTLIL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagttttagtccccgatatcggtggggatgaagtacaggttatc
gagatctgtgctgcggtaggcgataccctcgccgccgaagaatcgatcattaccgtcgaa
agcgacaaggcgaccatggatattcctgcgcctttcgccggtaagcttgccgagattaag
gtagccgtgggcgataccgtctctgaaggtacacttatcgccatgatggaagcgggtgag
gcgcaggccgccgagcctgcaccagcagaatctgcacctgttgccgctccagctgcaccc
gctccggcagcgcctgttgcttcagcgccagcctctgcacaagtgattgaagtgacagtg
ccggatatcggcgatgcctcagatgtcgacgtgattgaagtgctggtggccgtgggcgac
agcataaatgtcgacacagggcttatcacgcttgaaactgacaaggcgaccatggaagta
cctgcacctgcagccggtgtggtgaaagagatgaaagtggccgttggtgacaaggtctct
caaggctctctggttctgatgcttgaggtgagcggcggtgaagctgcggctcctgcggca
agcgcggctccagcaccaagcgcagaggctgcgccagcggccgctgccagcatcgaagtg
aaagagattagcgtgcccgatatcggcgatgcgtctgacgtcgatgttatcgaggtattg
gttgcggccggtgatgtgattgaggccgaccaaggcctgatcaccctggaaaccgacaag
gccaccatggaagtccctgcaccgttcgccggtaagctggtttctgtgaccgttaaggtg
ggcgacaaggtttctcagggcagcgtcatcgcgaccatagagacacagtcgagtgcgcct
gttgccgctcctgctccggccgctgcagcacctgcgccagttgcacaagccagcgcacca
gcgcctgcggcgagcaagccgcctgtgccccatcacccgagtgccggtagcaagccggta
accggtgccgtacacgcctcgccagcggttcgccgtctggctcgcgagtttggtgcagac
ctgactcaggtaactggtactggtcctaagggacgtattctcaaggaagacgttcaggcc
tttatcaagtatgaactgtctcgtcctaaagcctctgcggccactagcgtgggcgccggt
gagggggggctgcaggtgattgcagcgcctaaggttgatttcgctaagttcggtgaagtg
gaagaagtgccgctgagccgtatccagaagatatctggacctaacctgcaccgtaactgg
gtcactattccacacgtgactcaattcgacgaagccgacatcacagagatggaagccttc
cgtaagcagcaaaacgagattgccgccaagcagaagactggcgttaagatcacgcctctg
gtcttcatgatgaaggcggttgccaagacactgcagcagttcccagtgtttaacgccagc
ctgagcgccgacggtgagtcgctgatcaagaagaagtactaccatattggtgtggcggtt
gatacgccaaacggtctggttgtgcctgtggttcgtgatgtcgacaagaaaggcatcata
gagctgtcggccgaactgatggagatctcggttaaggcccgtgacggcaagctgaaagcg
gccgacatgcagggtagctgtttcaccatctctagcctgggtggcatcggtggtacggca
tttacgcctatcgttaactatcctgacgtggcgatcttaggggtttctaagtctgaaatt
aaacctaagtggaatggtaaagagttcgagcctaagttaatgttgccgctctctttatct
tacgaccaccgtgtgatcgacggcgccatggcggcacgcttcagcgtgaccctgtcaagt
atgctgtccgacatacgcacacttattttgtaa

DBGET integrated database retrieval system