KEGG   Shewanella loihica: Shew_3458Help
Entry
Shew_3458         CDS       T00489                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
slo  Shewanella loihica
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:slo00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:slo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4141280..4142746)
Genome map
AA seq 488 aa AA seqDB search
MHLCDLLAPWFHYAGGESLSHLTLDSREIGQGSVFVAVPGHRVDGRDYVDTALSQGAVAA
LIHTDDPAEHGKVSQDNGLRIYFFQLQRQLSALASQLYVLGRDRIKLIGVTGTNGKTSVT
QLIAQLSDGLGKPAAVMGTLGNGLWGQLVDSGNTTADPITVMRQLEDFDRQGTAVCAMEV
SSHGLVQGRVDAVPFDVAVFTNLSRDHLDYHGSMDAYGAAKQRLFRFSSLSHGLINLDDP
VGRQWIQDKRCKGLVGFSIQGQEGAAIYTKEVKQHSQGVSATLVWPEGEAKIDSPLLGIF
NLSNLVAALGALYLSGYAMAQLLTQVSSLKPVAGRMERFTTQEGVTLVVDYAHTPDAIEQ
ALRALRGHCRGKLWCVFGCGGDRDKGKRPLMARAAEENADCVMVTSDNARSEDPMAIIQD
VLAGLNKPQIALTQVDRQQAIREVVTLASNGDLILLAGKGHETYQEIAGKRLDYDERALA
AAIARGGK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcacctatgcgatctcctagccccctggtttcattatgccggtggcgagtccctcagc
catctgacgctggatagtcgagagataggccagggcagcgtgtttgtcgccgtgcctggt
cacagggtcgatggcagagactatgtcgataccgccctgtcgcaaggagccgtagcggca
cttattcataccgacgacccggcagagcatggcaaggtgagtcaggacaatggcctgcgt
atctatttctttcagctgcagcgtcagctgtcggcgctcgcctctcagctctatgtgttg
ggacgggataggatcaagctgatcggcgtgaccggcaccaatggtaagacatccgtaacc
caacttatcgctcagctaagcgacggtctgggcaagccggccgccgtcatgggcacccta
ggtaatggcctgtggggccagctggtcgacagcggtaataccacggcggatcccattacc
gtgatgcgccagctagaagattttgaccgccagggcaccgccgtgtgcgccatggaggtg
tccagccatggcttggtgcaggggcgcgtagacgcagtgcctttcgatgtggccgtgttt
actaacttgagtcgggatcatctggattatcacggttctatggatgcctatggcgcggct
aagcagcgcctgtttagattcagttcactgagccacggcttgatcaacctagacgaccct
gttgggcgtcagtggatccaggataaacgctgcaagggcttggtgggctttagtattcaa
ggccaggaaggcgctgctatctataccaaagaggtcaagcagcatagccaaggcgttagc
gcgaccttagtctggcccgaaggcgaggcgaagatcgactcgcccctgctgggtatcttc
aacctgtctaacttagtcgcggccttgggcgccctctatctgagcggctacgccatggcg
cagctgttgactcaggtgtccagcctcaaacctgtggcgggacgcatggagcgtttcacc
acgcaagaaggtgtcaccctggtggtggattacgcccacacgccggacgccatagagcag
gcgctgcgagccctgcgtggtcactgccgcggcaagctgtggtgtgtctttggctgtggc
ggcgaccgtgacaagggcaagcggcccttgatggcccgcgccgccgaggagaatgccgac
tgcgtcatggtgaccagcgacaatgctcgcagcgaagatcccatggcgatcattcaagat
gtattggccggactcaacaagccgcagatcgccctgactcaggtcgatagacaacaggcg
atccgcgaggtggtgaccctggcctccaacggcgacctcattttgctggccggtaagggt
catgagacctatcaggagatcgccggcaaacgcctggattatgatgaacgcgccctggcg
gcggcaattgcgaggggcggcaaatga

DBGET integrated database retrieval system