KEGG   Shewanella loihica: Shew_3486Help
Entry
Shew_3486         CDS       T00489                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
slo  Shewanella loihica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shew_3486 (folE)
Enzymes [BR:slo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Shew_3486 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4172245..4172889
Genome map
AA seq 214 aa AA seqDB search
MALSEAAKQVQTALLERGLETPMVPCGLSSEARKEKIEHHMREILTLMSLDLRDDSLVET
PKRIAKMYVDEIFSGLDYENFPKITVIENKMGFDEMVKVNDISLTSTCEHHLVTIDGVAT
VAYLPRKNIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSTTTTTALGGIFKSNPATRAEFLSN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgaagcagcaaagcaggtgcaaactgcattattagagcgtggtcttgag
acgcccatggtcccgtgcggactgagtagcgaggcgcgcaaagagaagattgagcaccat
atgcgcgagatcttaaccttaatgtcactggatctgcgcgacgacagcctggtcgagacc
cctaagcgtatcgccaagatgtatgtggatgagatcttctcgggcctggactacgagaac
tttcccaagatcacggttatcgaaaacaagatgggcttcgatgagatggtcaaggtcaac
gacatcagcctcaccagcacctgtgagcaccacctggtgaccatagacggcgtcgctacc
gtggcctacctgccgcgcaaaaacatcataggcctgtctaagatcaaccgtatcgtgcgc
ttctttgcccagcgccctcaggtgcaagagcgcctaacacaacaggtattggtggcgcta
cagacactgcttgagaccaaagatgtagcggtcaagatggatgcggtgcattactgcgtc
aaatcacgcggcgtgatggactctaccagcaccacgaccaccacggccctgggcggcatc
ttcaagtcaaacccagccacccgcgccgagttcctaagcaattaa

DBGET integrated database retrieval system