KEGG   Shewanella loihica: Shew_3723Help
Entry
Shew_3723         CDS       T00489                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
slo  Shewanella loihica
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:slo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4430676..4431665
Genome map
AA seq 329 aa AA seqDB search
MSTAPVSTSTDTIATSLPAFSSELTDNRQQLDAFWQGVEQGYLTTGDGLKLAYCVAAHPE
SNQAIVISSGRVEAYLKYQELIFDLYQLGYSVYALDHRGQGLSDRLTDNPHQGHVAKFSD
YVDDLGLFVDTLVIPKQHDRLFLVGHSMGGTIATLYLQQAPKVFDAAVLSAPMYGICLPM
PKPFVRWLAGHLDNGSSSKPNYVLGGKNYQPVPFEQNELTHSAKRYQDYRRLYETYPQLQ
LGSPTNRWLTESLDACEQAVEAAKHTQTPILILQAEEDSIVDNRAQDAARGEHCHLFKVA
HARHEIFIERDSARNQALGQLADFLSLHA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagccccagtctctacaagcactgacactatcgccacctcactgccggctttt
tccagcgaactgactgacaatcgtcagcagctagatgctttctggcagggtgtcgagcag
ggttatctgacgacaggcgatggactcaagctggcctactgcgtggccgctcaccccgag
tcgaatcaggcgatagtgatcagcagcggtcgtgtcgaggcctaccttaagtatcaagag
ctgatcttcgatctctatcagctgggatatagcgtctacgccctggaccacagaggacag
gggctttcagacaggctaaccgacaatccgcaccaggggcatgtagcgaaattttccgac
tatgtggatgaccttggcctcttcgtcgataccctagtcatccccaagcaacatgacagg
ctgtttctggtggggcactccatgggcggcaccatagcgaccctgtatctacagcaggca
cccaaggtgttcgatgcggcagtgttatcggcacccatgtatggcatctgcctgccgatg
cctaagcccttcgtgcgttggttggccggacacctggacaatggctcgagcagcaagccc
aactacgtcttagggggcaagaactatcagcccgtccccttcgagcagaacgagctcacc
catagcgctaagcgctatcaagactatcgtcggctgtatgagacctacccgcagctgcag
ctgggctcccccaccaaccgttggctaaccgagtccctcgatgcctgcgagcaagcagta
gaagccgcgaaacacactcagacgcctatcttgatcttacaggcagaggaagactccatc
gtcgacaatcgcgcgcaagatgctgccaggggagagcattgccacctgtttaaggtcgcc
catgcccgtcatgagatcttcatcgaaagggatagcgcccgaaaccaggcgctgggacaa
cttgcagactttctcagcctacacgcttga

DBGET integrated database retrieval system