KEGG   Syntrophothermus lipocalidus: Slip_0132Help
Entry
Slip_0132         CDS       T01253                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Slip_0132
Enzymes [BR:slp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Slip_0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140891..142078
Genome map
AA seq 395 aa AA seqDB search
MKGDHVVFIQDQREAEQFLREVGADEAGVRWMKTKAVFRAVKLKDIPCPAANIIKQEMLS
KGGEAAVKRGTVSGQGTTDVLLLGTVKQYQRLIKKLRMQPFGLKKIADELSEMLKNIEGT
GPTVMQLPRGQELVLGQRTLVMGILNVTPDSFSDGGHYYSFAAAVERALAIEEEGADILD
IGGMSTRPGHAPIPPEEELARVLPVVEALAGRINIPISVDTYRATVARACLEAGAGIIND
VGGLLFDSEMAQVVAELQAPVVVMHNRMPNRPPEGYRNLIDEMIEDLQVSLERAEQAGIP
KKNIIIDPGVGFGKIGEENFVILKRLREFKSLGYPLLLGVSRKSFIGAALNLPVGERLEG
SLAAAVIGILNGADIVRVHDVEATKRVATIADAVK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagaccatgtcgtgttcatccaagaccagcgcgaggcagagcagttcctgaga
gaagtcggggccgacgaggctggggtgcgatggatgaagaccaaggcggttttcagagcg
gtcaaactcaaagacatcccttgcccggcagccaacataatcaagcaggagatgctctcc
aagggcggcgaagcagctgtgaagaggggcacggtttcgggacagggaactaccgacgtg
ctcttactaggaaccgtaaaacagtaccagcggctcatcaagaagctccggatgcagccc
tttgggttaaagaagatcgccgacgaattgagcgagatgttgaaaaatatcgagggaacc
ggtccgaccgtgatgcagttgccccgggggcaggaactggttttggggcagcgtacgctt
gtaatggggattctgaacgtgacccctgattctttctcggacggagggcattattactcg
ttcgcagccgccgttgaaagagcgctggctatagaagaagaaggggccgacatcttggat
atcgggggtatgtcgacccggcctggacatgctcctattccgcccgaagaagaactggcc
cgggtcttgcctgtggtcgaagccctggctggccggataaacatcccgatctcggtggat
acttaccgcgctaccgtagcccgtgcctgcctggaagcgggtgccggcatcatcaacgat
gtggggggcttgctgtttgactccgagatggcacaggtggtagccgaactccaggccccg
gtggtggttatgcacaaccgcatgcctaaccggccacctgaaggttaccgaaatctcata
gacgagatgatagaagaccttcaggtgtctttagaacgggccgagcaggcggggattccg
aaaaagaacatcatcatagaccctggggtgggattcggcaagatcggcgaagaaaacttc
gtgatactgaagcggctgcgggagttcaagagcctggggtatcccttgctcttgggggtg
tcgcgcaaatcttttataggtgcggccttaaaccttccggtcggggaaagactggagggc
agcttggcagcagcggtcatcggtatcctaaacggagccgatattgtcagggtgcacgat
gttgaagcaaccaagcgcgtggcaaccatcgccgacgcagtcaagtaa

DBGET integrated database retrieval system