KEGG   Syntrophothermus lipocalidus: Slip_0321Help
Entry
Slip_0321         CDS       T01253                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Slip_0321
Enzymes [BR:slp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Slip_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329419..330360
Genome map
AA seq 313 aa AA seqDB search
MSSKVVGLGTAAMDVVLRCNTLPKSDGFAFVHEECLTPGGSCANVLTALSFLGVHTALVA
KIGDDSYGRLFLEDLKKCGVGADHVKVVAGGITLHTFIAVSPDGSRIVLANLGNTLLSLA
ADEVGPHMLEDARVFYTDMFPGKPALSLAQRCRDLGIPMVFNLQCPPSFMALCGVPKREL
AQMVTLSTLVISNAENLRELTGIDDIFRALEEVKRWGQPPEGVICTLGSEGAAWLYEKQV
LKKDAFPVKAVDTTGAGDAFAAGLIFALFYKGQSADEALAFANACAAIKCTQSGPRLRVT
ERDVLEFLKGFQY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaaaggttgtagggttaggtacagccgccatggatgtggttttgcgttgtaat
acgctgcccaaatctgatgggttcgcttttgttcatgaagaatgtttgactcccgggggg
agttgtgccaacgttctcactgctctgtcttttctcggcgtgcatacggctttggtagcc
aagataggggatgactcctacggcaggctcttcctcgaggacctcaaaaagtgtggggta
ggtgccgaccacgttaaggtagttgcagggggaattactcttcataccttcatcgctgta
tcccccgacgggtccaggatagtgttggctaacctcggcaataccttgctttcgctggca
gcagacgaagtcggtcctcacatgctggaagatgcccgcgttttctacaccgatatgttt
cccggcaaaccggccttgtccttagctcaaaggtgtagagacctgggaattcctatggtt
ttcaacctgcagtgtcccccgtccttcatggctttgtgcggggtgccaaaaagagagttg
gcacaaatggtgaccctcagtaccctggtgatcagcaacgccgaaaacctgcgggagctg
accggtatcgatgacattttccgggccctggaggaggtgaaacggtggggacagccgcct
gagggggtcatatgtactctgggctccgagggggctgcctggctgtacgaaaaacaagtg
ctgaagaaggacgcctttccggtaaaagccgtcgacactaccggggctggggacgcattt
gctgccgggctgatattcgctcttttctacaaggggcaaagcgctgacgaggccctcgca
tttgccaatgcctgtgcagcgataaagtgcactcaatccggacccaggttgagggtaacg
gaaagggatgttctcgagttcctaaaaggtttccagtattaa

DBGET integrated database retrieval system