KEGG   Syntrophothermus lipocalidus: Slip_0534Help
Entry
Slip_0534         CDS       T01253                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slip_0534
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slip_0534
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slip_0534
Enzymes [BR:slp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slip_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
555226..556587
Genome map
AA seq 453 aa AA seqDB search
MSRDALTKIILPEDKIPKYWYNVQADMPNPLDPPLNPRTGEPATPDDLLPIFPMGLIEQE
VSQERYIEIPQEVREIYRLWRPSPLYRAHRLEKALDTPCRIYYKYEGVSPVGSHKLNSAI
AQAFFNKIAGIKRLTTETGAGQWGTALALACRVFGLDCTVYMVKVSYEQKPYRRSIMETY
GATCLASPTDRTASGRAVLERDPDTPGTLAIAISEAVEDAASRDDTNYSLGSVLNHVCLH
QTVIGQEVKLQLEMVDEYPDVVIGCCGGGSNFSGIALPFIPDKLAGTNVRLIAVEPAACP
TLTKGVFAYDYGDQAGFTPLLKMYTLGHDFTPPGIHAGGLRYHGDSPLISRLYHDGLLEA
RAVFQKNVFEAAVLFAQTEGILPAPESAHAIRAAVDEALAGKEEGVSRCIVFNLSGHGHL
DISAYDSYLNGRIEDVEFSDEALAESLKTLPQV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagacgcccttactaagattatccttccggaggacaagattcccaagtattgg
tacaacgtgcaggctgacatgcctaacccgctggatccgcctttgaatccgcgcactggg
gagcctgcgactcctgatgatctattgccgatttttccaatgggtctcatcgaacaggag
gtttctcaggagcggtacatcgagattccccaggaagttagggaaatttatcggctgtgg
agaccgagccctctttatagagcccacaggttagaaaaagccctcgatactccctgccga
atctactataagtatgagggtgtcagcccggtcggcagtcacaagctcaacagcgctatc
gcacaagcgttctttaacaagatcgctgggatcaagcgccttacgacggagacgggagct
gggcagtggggaacagcgttagcgttagcctgtcgggtcttcgggctggattgtacggtg
tacatggttaaggtcagttatgaacagaaaccctaccgtcgctctataatggaaacctac
ggagcgacttgtctagccagccctaccgaccgaaccgcatccggaagggctgtgctggag
agagatcccgataccccaggtaccttggccatagctataagcgaggcggtggaagatgca
gccagccgggacgataccaactactccctgggcagcgttttgaaccacgtttgcctgcac
cagacggtcatcgggcaggaagtcaagctccagctggaaatggtggatgagtatcctgac
gtggtgatagggtgctgcggggggggcagcaacttttcgggcattgctttgcccttcata
ccggacaaacttgcaggaaccaatgtccgcctcatcgctgtggaaccggcagcttgtcca
accctgaccaaaggggtgtttgcgtatgactacggggaccaggccgggtttacccctttg
ctgaagatgtataccctgggccacgattttactccgcccggtatccatgcggggggcttg
cggtaccacggggattctccgcttataagccgactttatcatgacgggctactggaagcg
agggcggtattccagaagaatgtgttcgaagcggcggtgttgtttgcccaaaccgaaggc
attcttcctgctcccgagtcggctcacgccataagagcggcagtcgacgaagccttggct
ggcaaagaagagggggtcagccgctgtatcgttttcaatttaagcgggcacggccacctc
gatatctccgcctacgacagttacttgaatggcagaatagaagacgtggagttttcggac
gaagcactggcagagagcctgaagactctgccccaggtctag

DBGET integrated database retrieval system