KEGG   Syntrophothermus lipocalidus: Slip_0534Help
Entry
Slip_0534         CDS       T01253                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slip_0534
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slip_0534
Enzymes [BR:slp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slip_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
555226..556587
Genome map
AA seq 453 aa AA seqDB search
MSRDALTKIILPEDKIPKYWYNVQADMPNPLDPPLNPRTGEPATPDDLLPIFPMGLIEQE
VSQERYIEIPQEVREIYRLWRPSPLYRAHRLEKALDTPCRIYYKYEGVSPVGSHKLNSAI
AQAFFNKIAGIKRLTTETGAGQWGTALALACRVFGLDCTVYMVKVSYEQKPYRRSIMETY
GATCLASPTDRTASGRAVLERDPDTPGTLAIAISEAVEDAASRDDTNYSLGSVLNHVCLH
QTVIGQEVKLQLEMVDEYPDVVIGCCGGGSNFSGIALPFIPDKLAGTNVRLIAVEPAACP
TLTKGVFAYDYGDQAGFTPLLKMYTLGHDFTPPGIHAGGLRYHGDSPLISRLYHDGLLEA
RAVFQKNVFEAAVLFAQTEGILPAPESAHAIRAAVDEALAGKEEGVSRCIVFNLSGHGHL
DISAYDSYLNGRIEDVEFSDEALAESLKTLPQV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagacgcccttactaagattatccttccggaggacaagattcccaagtattgg
tacaacgtgcaggctgacatgcctaacccgctggatccgcctttgaatccgcgcactggg
gagcctgcgactcctgatgatctattgccgatttttccaatgggtctcatcgaacaggag
gtttctcaggagcggtacatcgagattccccaggaagttagggaaatttatcggctgtgg
agaccgagccctctttatagagcccacaggttagaaaaagccctcgatactccctgccga
atctactataagtatgagggtgtcagcccggtcggcagtcacaagctcaacagcgctatc
gcacaagcgttctttaacaagatcgctgggatcaagcgccttacgacggagacgggagct
gggcagtggggaacagcgttagcgttagcctgtcgggtcttcgggctggattgtacggtg
tacatggttaaggtcagttatgaacagaaaccctaccgtcgctctataatggaaacctac
ggagcgacttgtctagccagccctaccgaccgaaccgcatccggaagggctgtgctggag
agagatcccgataccccaggtaccttggccatagctataagcgaggcggtggaagatgca
gccagccgggacgataccaactactccctgggcagcgttttgaaccacgtttgcctgcac
cagacggtcatcgggcaggaagtcaagctccagctggaaatggtggatgagtatcctgac
gtggtgatagggtgctgcggggggggcagcaacttttcgggcattgctttgcccttcata
ccggacaaacttgcaggaaccaatgtccgcctcatcgctgtggaaccggcagcttgtcca
accctgaccaaaggggtgtttgcgtatgactacggggaccaggccgggtttacccctttg
ctgaagatgtataccctgggccacgattttactccgcccggtatccatgcggggggcttg
cggtaccacggggattctccgcttataagccgactttatcatgacgggctactggaagcg
agggcggtattccagaagaatgtgttcgaagcggcggtgttgtttgcccaaaccgaaggc
attcttcctgctcccgagtcggctcacgccataagagcggcagtcgacgaagccttggct
ggcaaagaagagggggtcagccgctgtatcgttttcaatttaagcgggcacggccacctc
gatatctccgcctacgacagttacttgaatggcagaatagaagacgtggagttttcggac
gaagcactggcagagagcctgaagactctgccccaggtctag

DBGET integrated database retrieval system