KEGG   Syntrophothermus lipocalidus: Slip_0710Help
Entry
Slip_0710         CDS       T01253                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slip_0710
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Slip_0710
Enzymes [BR:slp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Slip_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
728279..729406
Genome map
AA seq 375 aa AA seqDB search
MERSDLARCERIVVKVGTSTLTHPTHQLNLMRMEVLVREMADIHNQGKELLLVSSGAIGL
GVARLGLKEPPRTLPMKQAMAAVGQGTLVHMYEKLFSEYSKTVAQVLLTKDDFNERLRYL
NSRNTLLTLLGLGVIPIINENDTVVVDEIKFGDNDTLSALVAGAVDADLLVILSDIDGLY
DDDPRQNPKARRLPEVYEITDEMEKKSHRRGTKLASGGMYTKLLAAKIVMAAGIPMVVAH
GAEKNVLRRIIAGEPLGTLFVPKESRMQARKRWIAFGSACQGKVYIDNGAKEAVLHRGKS
LLPSGITGVEGIFERGNVISLVDLEGHEFARGITNYSAEEIKLIAGKKTSQIERILGHKD
YDEVIHRNNLTVYEA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggagcgaagtgacctggccaggtgcgagcgcatcgtggttaaggtagggaccagcacc
ttgactcatcctactcaccagctgaacctaatgcggatggaagtcctggtgagggagatg
gcggacatacataaccagggcaaagagctgctcttggtcagctcaggagcgatcgggctg
ggggttgcaaggctaggattgaaagagcccccccgtaccctacctatgaaacaggcgatg
gcggcagtaggacagggtacattagtccacatgtatgaaaagctgttttcggaatacagc
aaaaccgtggcccaggtcctcttgactaaggacgatttcaatgaaagactgcgatacctt
aacagccgtaatactctactcaccctgctgggactgggggtcatcccgatcataaacgag
aacgatacggtggtagtggacgagatcaagtttggggacaacgacaccctttcggctttg
gtggcaggggcggtggacgctgatctcctagtaattctttccgatattgacgggttgtac
gatgatgaccctcgccaaaacccgaaggccaggaggttacctgaagtgtacgaaatcacc
gacgagatggaaaaaaagtcccaccgtcgcggtacaaaactcgcgagcggcgggatgtac
accaagctcctggcagccaagatcgtcatggcagcggggatacccatggtagtggctcat
ggagcggaaaaaaacgtgctgcgcaggataatagcaggggaacctttggggactctgttc
gttcccaaagagagccggatgcaggcgcgcaagcgctggatcgctttcgggagtgcctgt
cagggaaaggtttatatcgataacggggcaaaagaagcggtcttacaccggggaaaaagc
cttttgccgagtggcataaccggcgtagaggggattttcgaacggggcaacgtgatttcc
ctggtagacttggaaggacacgagtttgcccggggtataacgaactactcagccgaagaa
atcaagctcattgccggtaagaaaacttcgcagatcgagcgcattctcgggcataaagat
tacgacgaggttatccaccgcaacaatctgaccgtgtacgaggcataa

DBGET integrated database retrieval system