KEGG   Syntrophothermus lipocalidus: Slip_0742Help
Entry
Slip_0742         CDS       T01253                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:slp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Slip_0742
Enzymes [BR:slp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Slip_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769015..769620
Genome map
AA seq 201 aa AA seqDB search
MIAFLRGILVDTGTDCVYLDVNGVGFEVTVPPRVLNRVTCIGQEVFLYTYLQTLENEFRI
YGFLDEDERQLFRTLLSIPGLGAKTCLGIVSSMTTEELYRAVLAQDEKSLTSVPGIGRKT
AQRLIFELQNKWPKTDLIATTASENLRSSWTDTISALETLGFKSSELIPILSQLQAKNEL
GEAVEENVRKVLRLKGASAKS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcttttttaaggggaatcttggtagacacaggcactgactgcgtgtacttggac
gtgaacggagtagggttcgaagtgacggtaccaccgcgtgtcctcaaccgtgtgacttgc
atagggcaggaagtctttctgtacacttatctgcagaccctggaaaacgagtttagaatt
tacggatttttggacgaagatgagcgccagctgttccggacgttattgagcattcctggt
ttgggagcgaagacttgtttggggatcgtatcctctatgactacggaagagctataccgc
gcggtgttggctcaggacgaaaagagcctgacgagtgtaccggggattgggcgtaaaacg
gcacaaaggctgatttttgagctgcaaaacaagtggcccaaaactgatttaatagctacg
acggcgagcgagaatctacgctcgagctggaccgataccatcagcgcattggaaacccta
ggttttaagagcagcgagctaattccaatcttatctcaattacaggccaaaaacgagcta
ggagaggcggtagaagaaaacgtgaggaaagttcttaggctgaaaggagcaagcgcaaag
tcctga

DBGET integrated database retrieval system