KEGG   Syntrophothermus lipocalidus: Slip_0790Help
Entry
Slip_0790         CDS       T01253                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Slip_0790
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Slip_0790
Enzymes [BR:slp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Slip_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
822552..824033
Genome map
AA seq 493 aa AA seqDB search
MARLENLISGLEVIETSGDLDKEIKGVQYDSRKIEPGYLFVCIPGFKVDGHDYVLPAVGA
GAIALLVEKPVAGTQGVTVVRVKDTRKALPIVASNFYGAPSRQLRLIGVTGTNGKTTTTH
LITSVLEEAGYQVGILGTLYARWRGKQESMAHTTPESVDLERFIRRVVDEGGDYTVMEVS
SHALDLGRVDCLDFDAAVFTNLTQDHLDYHRTMDDYREAKLKLFRRLKNKDGHFAVINRD
DPSWTVFRDATPSRVVTYGITDEAAVRATEVRVEPEGSCFTLKWPEGDLRLSLNLSGWFN
VSNALAAAAFALKEGISPEVIKRGLEKVSGIPGRFETVKCGQDFTVIVDYAHTPDGLENI
LKTARAIAKKRIITVFGCGGDRDRGKRPLMGKIAAECSDFSIITSDNPRSEDPLAIIEDI
VTGVKKVPNSRYTVIADRRVAIGQAINMAQAEDMVIIAGKGHETYQLLKDEVLPFDDREV
AKEFIKERLQSVQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcgagattggagaatcttatcagcggactcgaagttatagagacttcgggtgacctg
gataaggaaatcaaaggggtccaatacgattctcgtaaaattgagccaggttatcttttt
gtttgtattccgggattcaaggttgacgggcatgactacgttctcccagcggtgggagcg
ggagccatagcccttcttgtcgaaaaaccggtcgcaggaacacaaggggtgactgtggtg
agggttaaagatactcgcaaagcccttcctatagttgcttccaatttttatggggctcct
tcacggcaattacgattgataggggtaaccgggactaacggaaagacgaccaccactcat
ttgatcacttcggtcttagaagaggcggggtatcaagtgggaattttaggaaccctttat
gcccgctggaggggaaagcaggaaagcatggcccatactacccccgagtcggtcgatcta
gaacgatttatacgccgggtggtggacgaaggtggcgactacacggttatggaggtttct
tcccatgccctggatttgggcagggtcgattgtttagactttgacgcggcggtatttact
aaccttactcaggaccatcttgattaccatcgtacaatggacgattacagggaagcaaag
ctaaaactgtttcgcagactgaagaacaaagacggtcactttgccgtcataaaccgggat
gatccttcttggactgtgttcagagatgctactcctagccgggttgtgacttacggaatt
acggacgaagccgcggttagagccaccgaggttcgagtcgaacccgaggggtcttgtttt
actctaaaatggcctgaaggagatctgcggttaagtctcaacctatccggttggttcaac
gtttccaatgccttggcggcagctgcctttgctttgaaagaaggcatttctcccgaggtt
ataaagcggggcctagagaaggtatcaggaatcccgggaaggttcgagaccgttaagtgt
gggcaagactttacggtcattgttgactacgctcatactcccgatggactggagaatatc
cttaagaccgcccgggctatcgcgaagaagcggatcatcacagtttttggctgcggaggg
gacagagacagaggcaagcggccgcttatggggaaaatagctgcggagtgcagcgatttt
agtataataacttcggataaccctcgtagcgaggaccccttggctataatcgaagacata
gttacaggagttaagaaggttcctaacagcagatacaccgtaatagccgatcgtagggtg
gccataggtcaggctatcaatatggcccaggcggaagacatggttatcatagcggggaaa
gggcacgagacctaccagttgttaaaagatgaggtactgccgtttgatgaccgggaagtt
gcgaaggagttcataaaggagcgtcttcaaagtgtacagtag

DBGET integrated database retrieval system