KEGG   Syntrophothermus lipocalidus: Slip_1114Help
Entry
Slip_1114         CDS       T01253                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slip_1114
   01230 Biosynthesis of amino acids
    Slip_1114
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slip_1114
   00030 Pentose phosphate pathway
    Slip_1114
   00051 Fructose and mannose metabolism
    Slip_1114
   00052 Galactose metabolism
    Slip_1114
  Energy metabolism
   00680 Methane metabolism
    Slip_1114
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Slip_1114
Enzymes [BR:slp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Slip_1114
Protein phosphatases and associated proteins [BR:slp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Slip_1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1151934..1153016)
Genome map
AA seq 360 aa AA seqDB search
MHRIGVITGGGDCPGLNAVVRAVTKSAINLYGWEVIGFEDGFKGLVENRYRILDLQAVSG
ILHRGGTILGTTNRDNPFNFLIEENGQKEFRDMSAVVLENLDRLGIDALVVIGGDGSLNI
AYQLHQKGVKVVGVPKTIDNDLSATDLTFGFHTAVATAMDALDRLHTTAESHHRVMVLEV
MGRYAGWIALAAGIAGGADVILIPEIPFKLEKICEKIEERTLTGKKFSIIVVAEGAKPEG
GEMVVQKIVPESHDPVRLGGIGNKVGEEIERLTGKETRVTVLGHLQRGGSPNAFDRILST
RYGVAATKALKAGNYGSMVSLQGSAVTTVPLEDAIGELKKVPVDHEMIQVARAVGISFGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtatcggagtcattacagggggtggagattgtcctggactcaatgccgtggtc
agggccgtaaccaagtctgcaatcaacctttacggctgggaagtcattggatttgaagac
gggtttaaaggcttggtcgaaaatcgctaccgcatcttagacctgcaggccgtctccggg
atccttcaccgcggtggcactatcctcggaacgacgaaccgggataacccgttcaatttc
ctcatcgaggaaaacggccaaaaagagtttcgagatatgtcggcggtagtcctggaaaac
cttgaccggctcggcattgatgctttggtagtaatcggcggggacggaagtctcaatata
gcgtaccagctgcatcaaaaaggggtcaaagtggtcggggtccccaaaaccattgataac
gacctttcagctaccgatctcacctttggttttcatacggccgtagccacagctatggat
gcgctagaccgcctgcatactactgcggaatctcaccaccgggtaatggttctcgaagtg
atggggaggtacgcgggatggatcgctttagctgcagggatagccgggggagccgatgtt
atactcatacccgaaataccattcaagctggagaagatctgtgaaaaaatcgaagagcgc
acgttgactggcaagaaattcagcattatagtggttgctgaaggagccaagcctgaaggc
ggggaaatggttgttcaaaaaatagttcctgagagccacgatcccgtgaggctgggtgga
ataggtaataaggtaggtgaggagatagaaagattgaccgggaaggaaacacgggttacg
gttctcggtcacctacaaagaggtggcagccctaacgcctttgatcgcatcttatccact
agatatggagtagcggcaacaaaagctctgaaagctggcaattatggaagcatggttagc
ctgcaaggctcggccgtaaccaccgtgcctctcgaagacgcaattggcgagttgaaaaag
gtcccggttgatcatgaaatgattcaggttgcccgggccgtggggatcagctttggggat
taa

DBGET integrated database retrieval system