KEGG   Syntrophothermus lipocalidus: Slip_1424Help
Entry
Slip_1424         CDS       T01253                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Slip_1424
Enzymes [BR:slp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Slip_1424
Exosome [BR:slp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Slip_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1479236..1480210)
Genome map
AA seq 324 aa AA seqDB search
MAFPITRMRRLRKNEALRRMVRETSLSVDDFIYPLFVVYGENKKIPVTSMPGVYQLSCDM
LESEIQETVDLGIPAVLLFGIPENKDAAASSAYDDNGVVQQAVRLIKDRWPELLVITDVC
LCEYTDHGHCGVVTGTGTIDNDATLELLAQEALSHAKAGADIVAPSDMMDGRIGYIREAL
DASGFADTAVMAYAAKYASGFYGPFREAAESAPQFGDRKTYQMDPANSREALREIELDLA
EGADIIMVKPALAYLDVIARVRERFNHPLAAYNVSGEYAMVKAAAANGWLDEERIMMEVL
TAIKRAGADIIITYFAKEAARLLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttggcttttccaatcacacggatgagaagactgcgcaagaacgaagctttgagacgtatg
gtacgtgaaaccagtctatcggtggatgattttatctacccgttgttcgtggtttacggg
gagaacaaaaaaattcccgtcacatccatgcccggggtttaccagctttcatgcgacatg
ctcgagagcgagattcaggagacggtggaccttggcatccctgctgtcctgctcttcggg
atacctgaaaacaaggacgcggcagcgagttcggcttacgatgacaacggtgtggtacag
caggcggtgcggctcatcaaagaccgctggccagaactcctggttattaccgacgtttgc
ttgtgtgaatacacggatcacgggcattgcggggtagtcacaggcacaggaacgatcgac
aatgatgccacccttgagctactagcccaggaagccctgtctcatgccaaggctggagct
gatatagtggcgccttcggacatgatggacggacgcataggatatattcgggaagctttg
gatgcgagcggttttgccgacaccgcggtgatggcatacgcagctaagtatgcttcgggc
ttttacgggccttttagggaagcggcagagtcggccccccaattcggcgaccgcaagacc
tatcaaatggatccggctaacagccgggaggctttgcgcgaaatcgagctagacctagct
gaaggggcggacatcatcatggttaagccggccctggcatacctggatgttatcgctcgg
gttagagagcggttcaatcatcccctggctgcctataacgtcagcggagagtatgctatg
gtgaaggcggctgcggccaacggatggttagacgaggaaaggataatgatggaggtgttg
accgcgatcaagcgggctggggctgatatcatcattacctactttgccaaagaagcggcg
cgcttgctagggtga

DBGET integrated database retrieval system