KEGG   Syntrophothermus lipocalidus: Slip_1587Help
Entry
Slip_1587         CDS       T01253                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:slp01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:slp00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1658632..1660536)
Genome map
AA seq 634 aa AA seqDB search
MEGLWGYAGKMLEVDLSANKIKQRQLSPRFCQECLGGTGFNARIVYDEVPPGADALGPDN
VLVFSVGTLVGSPFPTASRTEVSAKSPITGLFGTSNSGMFFGLGLRKCGYDGVIVKGQAP
SGVYLLIEDERAEIRDASDLWGKDAWESLDILKARHGECQVALIGPAGENLVKFASIENG
YYDAWARTGLGAVMGSKRLKAVVIKGNQRVKICQPDKMFEVANKARELIQSSPFFVPFKS
YGSMNAAIPYGNFNALAAHNFTQGCLPDWHQEFARSRVEGFIKRNVACHACIIACAHWVE
IKDGKYRGLRMKDMEVTPVVSFGSQVGLKLEAVVKACEMGQRLGMDMVSAAGVIAMAIEL
FEQGFLSREEVGYDLAFGDDEAVLKLMHDIAYRQGIGDVLAEGTKRAGHRLRGGEERAMH
VKGLELPMIDPRGRWSTWTLGMLTNVRGGDHLRCRNPVENLRYNENRFEYQKERFGLGRK
VYQELDMPRGLKEQTIDIGDDTVDVALMSKWAEDLINLFNSVGVCIRPPVLHGVGPTVLA
EAYTAFTGLEMTPDALMLAAERAWNLMKLFNLREGEKPEDSAFPRRFYEQRVKGNALDEE
KTREVLKKYYHARGWDPETGKPTEEKLRQLGIIF
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttatggggctatgcaggaaaaatgttggaggtggatctttctgccaataag
attaaacagagacaactgagcccgcggttttgccaagaatgtttgggaggaacaggtttt
aacgctcgcatcgtgtacgatgaggtccctcccggagctgacgctctgggacctgataat
gtcttggttttcagcgtgggtactttggtaggttcaccctttcctacggcttcccggacc
gaagtatcggctaagtctccgattacaggcttatttgggacttccaactctggtatgttt
ttcggactgggactaagaaaatgtggatatgatggggttatagtaaaagggcaggcaccg
agcggggtgtatctcttgatagaggatgagcgagcagagattcgagatgcatctgacctg
tggggcaaggacgcgtgggagtccttggacattctgaaggcccgtcacggagaatgccaa
gtggctctgatcggtcctgccggagaaaacctggtaaaattcgcatctattgaaaacgga
tattacgacgcttgggcccgtacagggctcggtgcggtgatgggttctaagaggcttaaa
gcggtggtaatcaaaggaaaccaacgggtgaagatttgccagccggataagatgttcgag
gttgccaacaaagcccgggaactaatacagtcgtcgccgtttttcgttccgttcaagagt
tatggttcgatgaatgccgctattccttatggtaatttcaacgcgctagcagcccacaac
ttcacccagggttgtctgcctgactggcatcaggaatttgcccgatccagggtcgaaggc
tttataaagaggaacgtggcttgccacgcgtgcatcatagcgtgtgctcattgggtagag
ataaaggatggtaagtaccggggactgcggatgaaggacatggaagtgacaccggtcgta
tcttttggctcccaggtagggctgaagctcgaggctgtagtcaaggcttgtgaaatgggg
cagaggctggggatggatatggttagcgcagccggggtgattgccatggccattgaacta
ttcgagcaagggtttctatccagggaggaagttgggtacgatctggcttttggtgatgat
gaagctgtgctaaagctcatgcacgacattgcttaccgtcaagggataggcgacgtttta
gcagagggaactaaacgtgcaggtcaccgtttgagaggcggcgaagaaagagccatgcat
gtaaagggcctggagctgccaatgattgaccctcggggcaggtggtcaacctggaccttg
gggatgctgaccaacgtaaggggtggggaccatcttcggtgtcgaaacccggtagaaaac
ttgcgttacaacgagaacaggtttgaatatcaaaaagagcggtttgggctggggcgcaag
gtgtaccaagaactagatatgccacgtggattgaaggaacagacgatagatatcggagat
gataccgtggatgtcgcccttatgtcgaagtgggccgaagacctgattaacctttttaat
tcggttggggtttgtatccgaccgccggtattacatggggttgggccaacggtgctagct
gaagcatataccgcgtttaccggactcgagatgactccggacgcgttgatgctggcggcg
gaaagggcatggaacctgatgaagcttttcaacctccgggaaggcgaaaagcccgaagac
tcggcatttccgcgccgcttctacgaacagagagttaagggcaatgcattagatgaagaa
aagacccgagaagttttgaaaaagtattaccacgctcggggctgggaccccgaaacagga
aagccaaccgaagagaaactccgccaattagggataattttttga

DBGET integrated database retrieval system