KEGG   Syntrophothermus lipocalidus: Slip_1749Help
Entry
Slip_1749         CDS       T01253                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:slp01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:slp00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:slp00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1820849..1821631)
Genome map
AA seq 260 aa AA seqDB search
MNRLELRLRQLKEREEKGLIGFMMACEPDFATAVECAKALEEAGCDILEIGVPYADPIAD
GEVIERAHFRGVERGMNMTKALEFVRAVHDNCSLPLVMFSYFNPILRRGVEVFARELETA
GASAVIIPDLPLEEREKYDQIDVDIIPMLAPTADEQRMARADHYARSFIYCVSVAGVTGE
RDRLPDLTDYLSRVRARTSHPLAVGFGISSGAQVARIKDYADLVVVGSALVRIIEENSDD
KTRLLSELSALARNLKQALR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgtttagagctgaggttaaggcaattgaaagaacgggaagaaaaaggcctcata
ggcttcatgatggcgtgtgaacctgatttcgctacagcggtcgagtgtgcgaaagccctg
gaggaagccggttgtgacatcctcgaaatcggcgttccatacgctgacccgattgccgat
ggtgaggttattgaaagggctcactttcgcggggtggaacgagggatgaacatgacgaag
gcgttagagtttgtgcgagcggttcacgacaattgctcgctaccgttggtgatgttttca
tatttcaaccctattctgcgaaggggagttgaagtgtttgcccgggagcttgagacagcc
ggagcttcggcagttattataccggatctcccgttggaggagcgggaaaaatacgaccaa
attgatgtagacatcatcccgatgctggccccgacagctgacgaacagcgtatggccaga
gccgaccactacgcgcggagtttcatatactgcgtatcggtggcaggagttaccggcgag
cgcgaccggttgcccgacctcacagattatctgagccgggtcagggctcgcacatctcat
ccattggcggtcgggtttggaatctcgtctggagctcaggtggctagaataaaagactac
gcagacctagtagtggtggggagtgcgttggtacgcatcatagaggaaaactcagatgac
aagacacggcttctttcggaactgagcgctttggctagaaaccttaagcaggccttaaga
tag

DBGET integrated database retrieval system