KEGG   Syntrophothermus lipocalidus: Slip_1749Help
Entry
Slip_1749         CDS       T01253                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slip_1749
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slip_1749
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slip_1749
Enzymes [BR:slp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slip_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1820849..1821631)
Genome map
AA seq 260 aa AA seqDB search
MNRLELRLRQLKEREEKGLIGFMMACEPDFATAVECAKALEEAGCDILEIGVPYADPIAD
GEVIERAHFRGVERGMNMTKALEFVRAVHDNCSLPLVMFSYFNPILRRGVEVFARELETA
GASAVIIPDLPLEEREKYDQIDVDIIPMLAPTADEQRMARADHYARSFIYCVSVAGVTGE
RDRLPDLTDYLSRVRARTSHPLAVGFGISSGAQVARIKDYADLVVVGSALVRIIEENSDD
KTRLLSELSALARNLKQALR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgtttagagctgaggttaaggcaattgaaagaacgggaagaaaaaggcctcata
ggcttcatgatggcgtgtgaacctgatttcgctacagcggtcgagtgtgcgaaagccctg
gaggaagccggttgtgacatcctcgaaatcggcgttccatacgctgacccgattgccgat
ggtgaggttattgaaagggctcactttcgcggggtggaacgagggatgaacatgacgaag
gcgttagagtttgtgcgagcggttcacgacaattgctcgctaccgttggtgatgttttca
tatttcaaccctattctgcgaaggggagttgaagtgtttgcccgggagcttgagacagcc
ggagcttcggcagttattataccggatctcccgttggaggagcgggaaaaatacgaccaa
attgatgtagacatcatcccgatgctggccccgacagctgacgaacagcgtatggccaga
gccgaccactacgcgcggagtttcatatactgcgtatcggtggcaggagttaccggcgag
cgcgaccggttgcccgacctcacagattatctgagccgggtcagggctcgcacatctcat
ccattggcggtcgggtttggaatctcgtctggagctcaggtggctagaataaaagactac
gcagacctagtagtggtggggagtgcgttggtacgcatcatagaggaaaactcagatgac
aagacacggcttctttcggaactgagcgctttggctagaaaccttaagcaggccttaaga
tag

DBGET integrated database retrieval system