KEGG   Syntrophothermus lipocalidus: Slip_1750Help
Entry
Slip_1750         CDS       T01253                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00260  Glycine, serine and threonine metabolism
slp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
slp01100  Metabolic pathways
slp01110  Biosynthesis of secondary metabolites
slp01130  Biosynthesis of antibiotics
slp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slip_1750
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slip_1750
Enzymes [BR:slp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slip_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADI02506
UniProt: D7CP71
Position
complement(1821628..1822815)
Genome map
AA seq 395 aa AA seqDB search
MYPDEKGYYGEYGGRYVPETLMPVLEELAREYEKLKDDLDFKRELSYYLHQYVGRPSGLH
FAKRLSRELGGARIYLKREDLNHTGSHKINNTMGQALLAKKMGKTRVIAETGAGQHGVAT
ATAAAVLGLSCTVYMGARDMERQRLNVFRMKALNAEVKAVAKGSQTLKEATDEAFRDYIA
SSDYTHYLIGSVVGPHPYPMIVRDFQSIIGRELRRQILEEEGKLPQYIIACVGGGSNAMG
IFYEFLQDDVRLVGVEAGGLGLDTGQHAATLNRGSRGVLHGALSTVLQDEEGQVLPTHSV
SAGLDYPGVGPEHSYLKDSGRVEYTSVTDEEALSAFLTLSRMEGIIPALESAHAVAYATK
IAPTLSRDDCIVVNLSGRGDKDVETVAAILEGVRP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccctgacgaaaaaggctactacggagaatacgggggacggtacgtgccggagacc
ctgatgccggtactagaggaactggctcgcgaatacgaaaagctgaaagatgacctggat
tttaagagagaactctcttactatctacaccagtacgtgggacggccttcgggactgcat
tttgccaaaaggctgagccgggagctggggggagccaggatctacctcaagcgggaggac
ctcaaccacaccggctcccataaaataaataacaccatgggccaagctctgttggcaaaa
aagatggggaagaccagagtcatagcggaaaccggggctggccagcacggagtggccacg
gctacagcggcggccgtactgggcctatcctgcaccgtttacatgggagccagggatatg
gaacggcagaggctcaacgttttccggatgaaggctttgaacgctgaagtcaaggcggtg
gcgaaaggatcccagaccttgaaagaagccacggacgaggccttccgcgactacatcgcg
agcagcgactatacccattacctcatcggatccgtggtgggaccacacccttaccccatg
attgtacgggatttccagtctatcatcggcagggaactgcgccggcagatacttgaagaa
gagggcaagctgcctcagtacatcatcgcttgtgtagggggtgggagcaatgccatgggc
atattctacgaattcttacaagacgacgtgcggctagtcggtgtggaggcgggcggcctg
ggtttggacaccgggcagcacgccgctaccttgaaccgcgggtcccgaggggtgctccac
ggtgctctaagcactgtactgcaggacgaagaagggcaggtgctgcctacgcattctgtt
tctgctgggttggattaccccggggtagggccagaacactcgtatctaaaagactcggga
cgggtagagtacaccagcgtgaccgatgaagaagccctgtcggctttcctgactttgagc
cggatggaggggattattcctgcccttgaaagcgctcatgccgtggcctatgcgacaaaa
atagccccgactctttcccgggacgactgcattgtagtgaacctgtcggggcggggcgac
aaggacgtggagacggtggctgccatactcgagggggtgaggccgtga

DBGET integrated database retrieval system