KEGG   Syntrophothermus lipocalidus: Slip_1750Help
Entry
Slip_1750         CDS       T01253                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slip_1750
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slip_1750
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slip_1750
Enzymes [BR:slp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slip_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1821628..1822815)
Genome map
AA seq 395 aa AA seqDB search
MYPDEKGYYGEYGGRYVPETLMPVLEELAREYEKLKDDLDFKRELSYYLHQYVGRPSGLH
FAKRLSRELGGARIYLKREDLNHTGSHKINNTMGQALLAKKMGKTRVIAETGAGQHGVAT
ATAAAVLGLSCTVYMGARDMERQRLNVFRMKALNAEVKAVAKGSQTLKEATDEAFRDYIA
SSDYTHYLIGSVVGPHPYPMIVRDFQSIIGRELRRQILEEEGKLPQYIIACVGGGSNAMG
IFYEFLQDDVRLVGVEAGGLGLDTGQHAATLNRGSRGVLHGALSTVLQDEEGQVLPTHSV
SAGLDYPGVGPEHSYLKDSGRVEYTSVTDEEALSAFLTLSRMEGIIPALESAHAVAYATK
IAPTLSRDDCIVVNLSGRGDKDVETVAAILEGVRP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccctgacgaaaaaggctactacggagaatacgggggacggtacgtgccggagacc
ctgatgccggtactagaggaactggctcgcgaatacgaaaagctgaaagatgacctggat
tttaagagagaactctcttactatctacaccagtacgtgggacggccttcgggactgcat
tttgccaaaaggctgagccgggagctggggggagccaggatctacctcaagcgggaggac
ctcaaccacaccggctcccataaaataaataacaccatgggccaagctctgttggcaaaa
aagatggggaagaccagagtcatagcggaaaccggggctggccagcacggagtggccacg
gctacagcggcggccgtactgggcctatcctgcaccgtttacatgggagccagggatatg
gaacggcagaggctcaacgttttccggatgaaggctttgaacgctgaagtcaaggcggtg
gcgaaaggatcccagaccttgaaagaagccacggacgaggccttccgcgactacatcgcg
agcagcgactatacccattacctcatcggatccgtggtgggaccacacccttaccccatg
attgtacgggatttccagtctatcatcggcagggaactgcgccggcagatacttgaagaa
gagggcaagctgcctcagtacatcatcgcttgtgtagggggtgggagcaatgccatgggc
atattctacgaattcttacaagacgacgtgcggctagtcggtgtggaggcgggcggcctg
ggtttggacaccgggcagcacgccgctaccttgaaccgcgggtcccgaggggtgctccac
ggtgctctaagcactgtactgcaggacgaagaagggcaggtgctgcctacgcattctgtt
tctgctgggttggattaccccggggtagggccagaacactcgtatctaaaagactcggga
cgggtagagtacaccagcgtgaccgatgaagaagccctgtcggctttcctgactttgagc
cggatggaggggattattcctgcccttgaaagcgctcatgccgtggcctatgcgacaaaa
atagccccgactctttcccgggacgactgcattgtagtgaacctgtcggggcggggcgac
aaggacgtggagacggtggctgccatactcgagggggtgaggccgtga

DBGET integrated database retrieval system