KEGG   Syntrophothermus lipocalidus: Slip_1764Help
Entry
Slip_1764         CDS       T01253                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slip_1764
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slip_1764
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Slip_1764
Enzymes [BR:slp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Slip_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1835333..1836835)
Genome map
AA seq 500 aa AA seqDB search
MMKYVSTRGQAQPVSSAEAIKLGIAPDGGLFVPEEEVRLKCDELAAMRGMNYQERAVMVL
TKFLTDFLEKEIKEYVDAAYSPERFDHPHVAPVARLDNSTYILELWHGPTCAFKDMALQL
LPHLLTASTRKTGEKAHIAVLVATSGDTGKAALEGFKDVPGTSIIVFYPAQGVSQVQERQ
MVTQEGSNVHVVAVEGNFDDAQNGVKAMFQNQGLETAMAVRGIKFSSANSINWGRLVPQV
VYYISAYLDLVSADVIEEGMPVNFVVPTGNFGNILAAFYSKQMGLPINKLICAANANNVL
TDFINSGVYDRNRSFKKTISPSMDILISSNLERLLYEITEHNDQKVRDWMDSLRERGRYE
VDSWVLERIQNSFWSDFATDEETKATIRDTYNTYGYLLDTHTAVGKKVYDRYVRVTGDTT
PTVIASTASPFKFAGSVAEAVFGMEIAAEHDEFGLSRLLSEKCNLSIPKGLQGLETRPIR
HYRKVLPEEMANVVLDILSG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtatgtgagcacaagaggccaagcgcaacccgtaagttcagctgaggctata
aagttgggtatagctcctgacggcggattgttcgttcccgaagaagaagttcgcctgaaa
tgcgacgaactagcagcgatgcgtggaatgaattaccaggaaagggctgtaatggtttta
accaagtttttgaccgatttcttggagaaagagatcaaggaatacgtcgacgctgcttac
agccccgaaagattcgaccatcctcatgtcgctccagtggccaggctcgacaacagtacc
tacatcttagagctctggcatggcccgacctgcgcttttaaagacatggccttgcagctt
ttgccgcacctgctcactgccagtacccgtaaaacgggagaaaaggcccacatcgctgtg
ttggtagcaacttctggcgatacaggcaaagcggccttggaaggattcaaagacgtgcca
gggaccagtatcatcgttttttatccggctcaaggggtgagccaggtccaggagcggcag
atggtaacccaggaagggtccaacgtgcatgtggttgctgtggagggcaacttcgatgac
gcccagaacggggtcaaagccatgttccagaaccagggtctggagacggcaatggcggtg
cgagggataaaattttcttcggccaactctattaactgggggcgcctggttccacaggta
gtatattatatttctgcttaccttgatctcgtaagcgcggacgtcatagaagaaggaatg
ccagtcaacttcgtggttcccaccggcaacttcggcaacattttggcagcgttctattcg
aaacagatgggtttgcccataaacaagctgatatgcgcggctaatgccaacaatgttttg
accgatttcataaatagcggagtttatgaccgtaaccggtctttcaaaaagaccatctcg
ccttcaatggatattctgatatcgagcaacctggaaaggctcctatacgagattacagaa
cacaatgatcaaaaggtgcgggactggatggacagcctgcgggagcgggggagatatgaa
gtggactcctgggttctggagaggattcagaattctttctggagcgattttgcaaccgat
gaagaaacgaaggcaactatccgcgatacttacaacacatatggttatctcttagacacc
catacggcggtaggcaagaaggtctacgaccggtatgtaagggttactggggacactact
cccaccgttatagcttctacggccagtccattcaagtttgccggaagcgtagctgaagct
gtcttcggcatggagatagccgcagagcatgacgaatttggtctatcacgactgctgtca
gaaaaatgtaacctgtccatcccgaagggcttgcaggggcttgaaaccagacctatcaga
cactaccgtaaggtattgcccgaagagatggcgaacgtagtgctagatatacttagtggt
tag

DBGET integrated database retrieval system