KEGG   Syntrophothermus lipocalidus: Slip_1764Help
Entry
Slip_1764         CDS       T01253                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slip_1764
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slip_1764
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Slip_1764
Enzymes [BR:slp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Slip_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1835333..1836835)
Genome map
AA seq 500 aa AA seqDB search
MMKYVSTRGQAQPVSSAEAIKLGIAPDGGLFVPEEEVRLKCDELAAMRGMNYQERAVMVL
TKFLTDFLEKEIKEYVDAAYSPERFDHPHVAPVARLDNSTYILELWHGPTCAFKDMALQL
LPHLLTASTRKTGEKAHIAVLVATSGDTGKAALEGFKDVPGTSIIVFYPAQGVSQVQERQ
MVTQEGSNVHVVAVEGNFDDAQNGVKAMFQNQGLETAMAVRGIKFSSANSINWGRLVPQV
VYYISAYLDLVSADVIEEGMPVNFVVPTGNFGNILAAFYSKQMGLPINKLICAANANNVL
TDFINSGVYDRNRSFKKTISPSMDILISSNLERLLYEITEHNDQKVRDWMDSLRERGRYE
VDSWVLERIQNSFWSDFATDEETKATIRDTYNTYGYLLDTHTAVGKKVYDRYVRVTGDTT
PTVIASTASPFKFAGSVAEAVFGMEIAAEHDEFGLSRLLSEKCNLSIPKGLQGLETRPIR
HYRKVLPEEMANVVLDILSG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtatgtgagcacaagaggccaagcgcaacccgtaagttcagctgaggctata
aagttgggtatagctcctgacggcggattgttcgttcccgaagaagaagttcgcctgaaa
tgcgacgaactagcagcgatgcgtggaatgaattaccaggaaagggctgtaatggtttta
accaagtttttgaccgatttcttggagaaagagatcaaggaatacgtcgacgctgcttac
agccccgaaagattcgaccatcctcatgtcgctccagtggccaggctcgacaacagtacc
tacatcttagagctctggcatggcccgacctgcgcttttaaagacatggccttgcagctt
ttgccgcacctgctcactgccagtacccgtaaaacgggagaaaaggcccacatcgctgtg
ttggtagcaacttctggcgatacaggcaaagcggccttggaaggattcaaagacgtgcca
gggaccagtatcatcgttttttatccggctcaaggggtgagccaggtccaggagcggcag
atggtaacccaggaagggtccaacgtgcatgtggttgctgtggagggcaacttcgatgac
gcccagaacggggtcaaagccatgttccagaaccagggtctggagacggcaatggcggtg
cgagggataaaattttcttcggccaactctattaactgggggcgcctggttccacaggta
gtatattatatttctgcttaccttgatctcgtaagcgcggacgtcatagaagaaggaatg
ccagtcaacttcgtggttcccaccggcaacttcggcaacattttggcagcgttctattcg
aaacagatgggtttgcccataaacaagctgatatgcgcggctaatgccaacaatgttttg
accgatttcataaatagcggagtttatgaccgtaaccggtctttcaaaaagaccatctcg
ccttcaatggatattctgatatcgagcaacctggaaaggctcctatacgagattacagaa
cacaatgatcaaaaggtgcgggactggatggacagcctgcgggagcgggggagatatgaa
gtggactcctgggttctggagaggattcagaattctttctggagcgattttgcaaccgat
gaagaaacgaaggcaactatccgcgatacttacaacacatatggttatctcttagacacc
catacggcggtaggcaagaaggtctacgaccggtatgtaagggttactggggacactact
cccaccgttatagcttctacggccagtccattcaagtttgccggaagcgtagctgaagct
gtcttcggcatggagatagccgcagagcatgacgaatttggtctatcacgactgctgtca
gaaaaatgtaacctgtccatcccgaagggcttgcaggggcttgaaaccagacctatcaga
cactaccgtaaggtattgcccgaagagatggcgaacgtagtgctagatatacttagtggt
tag

DBGET integrated database retrieval system