KEGG   Syntrophothermus lipocalidus: Slip_1844Help
Entry
Slip_1844         CDS       T01253                                 

Definition
PGAP1 family protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
slp  Syntrophothermus lipocalidus
Brite
Enzymes [BR:slp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Slip_1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1897567..1898322)
Genome map
AA seq 251 aa AA seqDB search
MDNVHPKAEPFLLTGNSGTCILLIHGFTSSPSELRELGERLNQQGFTVRAPLLPGHGSSP
VDLNETTWRDWYGKVKGEVEGLQSLCSSLFLVGLSMGGLLALKAAAELEGIRGVVTINAP
IFFKGSLVPFARILRFIRPYMPKKLDDNYRIMREQDRFAYDEIPVKAFLSVRELSRQVVR
DLKNVKVPVLIFQSKNDESIEERSALVIRGQVGSQEENLIWLEKSSHVATMGPELSFITR
EICRFIHKHTN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgtccatcccaaggcagaaccgtttctcctaaccgggaactcgggaacatgc
attctgttaattcatggttttacttcttctccatctgagctgagggaattgggagaaaga
ctgaaccaacagggcttcaccgtgagggcacccttattgcctgggcacgggtcgagcccg
gttgacctcaatgagactacctggcgcgattggtacggtaaggtgaaaggggaggtagaa
ggtctgcaatctctttgcagttcgctgtttctggtggggctgtccatgggtggactgtta
gccctgaaggctgcggccgagttagaagggataaggggagtagttacgattaacgctcct
atttttttcaaaggttccctggtgccgtttgctcgcatcctgaggttcatcagaccgtat
atgcccaagaaactggatgacaactaccgcattatgagggaacaggaccggtttgcttat
gacgagataccggtaaaggcgtttttgagtgttagggagttgtcaagacaggtggtcagg
gacttgaaaaacgtcaaggtgccggttctgatttttcaatccaagaacgacgagtctatc
gaggagagaagtgctctggttatcaggggccaagtggggagccaagaagaaaaccttata
tggcttgaaaaatcgagtcatgtggctacaatggggcctgagttatcgttcataactaga
gagatatgtcggtttattcataaacataccaattag

DBGET integrated database retrieval system