KEGG   Syntrophothermus lipocalidus: Slip_1850Help
Entry
Slip_1850         CDS       T01253                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slip_1850
   01230 Biosynthesis of amino acids
    Slip_1850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slip_1850
   00051 Fructose and mannose metabolism
    Slip_1850
   00562 Inositol phosphate metabolism
    Slip_1850
Enzymes [BR:slp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Slip_1850
Exosome [BR:slp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Slip_1850
  Exosomal proteins of bladder cancer cells
   Slip_1850
  Exosomal proteins of melanoma cells
   Slip_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1904049..1904822)
Genome map
AA seq 257 aa AA seqDB search
MRLPIIAANWKMHKTVKDSLQFAEEFIEMLGEDHKGIEIVICPPFTALYLLGKRLRGTGI
EAGAQDVFWEEWGAYTGEVSPGMILETGAKYVIIGHSERRHILGEGDTAVNRKVKRALAS
GLVPIMCVGETLAEREEGRAVSVVRRQLEEGLKGVELLRPHLVIAYEPVWAIGTGVNASP
QDAQEMSRLIRDELGGLFGVEVAQEMRILYGGSVNPGNIGGFVAQPDIDGALVGGASLEA
RSLADIVKQTEESVYGS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgagactacctattatcgctgctaattggaaaatgcataaaacggtaaaagacagtctg
cagttcgccgaagagttcatagagatgctgggtgaagaccacaaggggatagagatagtg
atatgtccgccgtttaccgccctctatttgttaggaaagaggctcagaggtactggtatc
gaagcgggggcccaggacgtgttttgggaggaatggggtgcttacaccggagaggtatcg
ccagggatgatcctggagaccggggccaagtatgtgataatcggtcactcggagcggcgt
catattttgggtgagggtgacacggccgtcaaccgcaaggtcaaaagggctttggccagc
gggcttgtccccattatgtgtgtcggcgagaccctggccgagcgggaagaggggagggcg
gtttcagtagtccggcggcagttggaggaaggattaaaaggggtcgaactgttgcggccc
cacctggttatagcctacgagccggtctgggccatcggaacgggggtgaacgcttcgcct
caggatgcccaggaaatgagccgcttaatccgggatgaactaggcggtctttttggggtg
gaagtcgcgcaagagatgaggatattatatgggggcagtgtgaaccctggcaatatagga
ggttttgtcgcccaacccgatattgacggggctctggtagggggagcaagccttgaagct
cgttctcttgcagacatcgtgaagcagacggaggaatcagtctatggtagctag

DBGET integrated database retrieval system