KEGG   Syntrophothermus lipocalidus: Slip_1859Help
Entry
Slip_1859         CDS       T01253                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slip_1859
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slip_1859
   00052 Galactose metabolism
    Slip_1859
   00500 Starch and sucrose metabolism
    Slip_1859
   00520 Amino sugar and nucleotide sugar metabolism
    Slip_1859
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Slip_1859
   00524 Butirosin and neomycin biosynthesis
    Slip_1859
Enzymes [BR:slp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Slip_1859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1913791..1914861)
Genome map
AA seq 356 aa AA seqDB search
MRLMKVAPRENGSPLKARSWIVGVDLGGTKILAGLGDTEGNIRAELKVATRAEEGPERVV
GRIAQTVCELLQHTGVKEKEIGAMVVGAPGPLDPSSGIVYQPPNLPGWDSFPLKERLSGY
FPDFPVMIDNDANLAALGEYRFGYQQVFDNLLFMTVGTGIGGGIILDGRIHHGACGAAGE
FGHMVILPEDGPLCGCGNHGCLETLASGTAIAREARDMVRAGKGALLWELAGRDMERLTA
EVVGEAARKGDEAASEIIARAGYYLGIGLANLVNIFNPAAIVIGGGVVSGLGELLLVPAR
EEMKRRAMKLQGEKVQVLRGKLGTRAGLLGCFALAAQKYPTTPNLCQSVAEIKEGF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttgatgaaggtcgcaccgagggaaaacggctcaccactgaaggcacgttcctgg
attgtgggggtggatttgggcgggaccaagatcctggcgggattaggcgataccgaaggc
aatatcagggcggagcttaaggtcgctaccagagcagaagaaggcccggaaagggtagta
ggacgaatagcacaaacggtgtgcgaactgcttcaacataccggggtgaaggaaaaagag
atcggagctatggtagtaggggcaccggggcctctcgatccttcgtctggtatcgtctac
cagccacctaaccttccggggtgggacagttttcccctaaaagagaggttgtccggttat
tttccggacttcccggtgatgatagacaatgacgctaacctggcagctttgggcgagtat
cgtttcggttaccagcaggtttttgacaacctgctctttatgactgtggggaccgggatc
ggcgggggaatcatcctggacgggcgaattcatcatggagcctgcggggcggcgggggaa
ttcggccatatggtgatactgccggaagacggtcccctttgcggatgtggaaaccacggc
tgtctggaaacgctggcttcgggaacggccatagcgcgggaagcccgggacatggtaaga
gccggcaaaggggctttgctgtgggaactggcaggccgcgatatggagcgcttgactgca
gaggtggtcggggaagcggcaagaaaaggagacgaagcggctagcgagatcatcgcccgg
gctggatactatctgggaatcgggttggccaatctggttaatattttcaacccggcagcc
atagtcataggaggaggggttgtctctggtttgggagaattactgctggtacccgcccgg
gaggaaatgaagcgacgggccatgaagcttcaaggcgagaaagtgcaggtattgcgaggt
aaactgggtactcgcgccgggctgttaggatgtttcgcgctggccgcccaaaaatatcca
accacgcccaatctgtgtcaatctgtggctgaaatcaaggagggattttga

DBGET integrated database retrieval system