KEGG   Syntrophothermus lipocalidus: Slip_2093Help
Entry
Slip_2093         CDS       T01253                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Slip_2093
Enzymes [BR:slp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Slip_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2129479..2130588)
Genome map
AA seq 369 aa AA seqDB search
MKSYFKLARHEGNRMLFDLVEMSIISTYCGEAFHLHAEGVRGAGKTTIMRAARDILPKIR
RIKDCIYNCDPENPHCPVHRHLGTEEIQSLGIEEIPMPFLEISHSAKVGTVAGSIDLAKI
TDQVKPQAALLPGIIPQAHRGILFIDEINRLADTSPEITDILLDVMGNKPGRLQIEEAGL
PVVEIPITVSVWAASNPDEEPGPLEEVRRQLSDRFDMVYYMGRAGSVEVVAQMLLSTRKT
KTGVDAEEVNSANAEYRKKIVEMARMYEVAEMPDYLRDFIARMYVKHNLESLRAVEAIQQ
GAILYSVLHKRKQVTISDVIDMVPLALKHRVDGDTFLKVTNSLTYESPRKRILNLLGRKQ
ETGEAGSAG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtattttaaacttgccaggcacgaagggaaccggatgctatttgacctggtt
gagatgtctatcatatctacctactgcggggaagcttttcacctgcatgccgaaggagtg
cggggagcagggaaaaccacgataatgcgggcggcccgggacatattaccgaagattaga
aggattaaggactgtatatataactgtgacccggagaatccgcactgtccagtacacagg
cacctgggaacggaagagatacagtctcttgggatagaggaaataccaatgccttttttg
gagatatcgcattccgccaaagtggggacggtagcggggagtatcgacttggcgaagata
accgaccaggtcaaaccgcaggcggctcttttgcccggcatcataccgcaggcgcacaga
gggatacttttcattgacgagataaaccggttagctgacacttcaccggagataaccgat
atcctgctggacgtaatgggtaacaagccgggcaggctacagatcgaggaagcgggcctc
ccagtagtagaaattcccatcacggtatcggtgtgggcggcttccaaccctgacgaggaa
ccggggcccctggaagaggtgcggaggcagctatcggaccgatttgacatggtctactac
atgggaagagcggggtcggtggaagtagtcgcgcaaatgctgttgagtacccggaagacc
aagacgggagtggatgccgaagaagtaaactcggctaacgccgagtaccgtaagaagata
gttgagatggccaggatgtacgaggtggcggagatgccggactatctccgcgactttatc
gcccggatgtatgtcaagcacaacctggagagcctgcgggctgtcgaagctatccagcaa
ggggccattctgtacagtgtactgcacaaacggaagcaggttaccatcagtgatgtgatc
gacatggttccgctggcgctcaagcaccgggtagatggtgatacttttcttaaggtcact
aatagcctgacctacgaatctccaagaaaaagaatactgaacctgctcggaagaaagcag
gagacgggggaggctgggtcggcaggataa

DBGET integrated database retrieval system