KEGG   Syntrophothermus lipocalidus: Slip_2261Help
Entry
Slip_2261         CDS       T01253                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:slp00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Slip_2261
Enzymes [BR:slp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Slip_2261
Amino acid related enzymes [BR:slp01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Slip_2261
Transfer RNA biogenesis [BR:slp03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Slip_2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2284526..2285980)
Genome map
AA seq 484 aa AA seqDB search
MKVRVRFAPSPTGPLHIGGARSALFNFLFAKRYGGEFIVRIEDTDLERSSRDYEAEIIES
LEWLGITWDEGIKVGGPNGPYRQTERLDIYQRWVDILVSTGWAYPCFCTEEELEEEREQL
MKQGETPRYLGRCRNLDEAERQAKLAQGLRPTIRFRVPEHRVFVVEDLVRGRVAFESENM
GDFIIVKSDGLPTYNFAVVIDDHLMGITHVIRAEEHLSNTPRQLMIYEALGLEPPKFAHI
SLILGDDRQKMSKRHGATSVIQYRQQGYLPEALVNFLALLGWAPEGEEEIMSLADIANSF
SLERVAKNPAVFDVDKLNWINQQYIKRKSTEELKELLWPFIERAGYRDEVKSLGDEKYTL
LVETMRDYLVCLSDITDKLDLVFKDAEPDHEAEKVLLQEGVVQVLRLCSERILDQEASPQ
EMDKFLKSLVKDAGVSAKKVYMPLRAALTGKVKGPELPYLMALWGTNEVRRRLERAVKRT
ETES
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagagtaagattcgctcccagccctacaggaccgcttcacatcggaggggct
agatcagccctgtttaattttctttttgccaaaagatacgggggagaattcatcgtaagg
attgaggatactgacttggaacgttcctcgcgggactatgaagcggagataatcgagtcc
ttggaatggttgggaatcacttgggatgaagggataaaggtagggggaccgaacgggcct
tatcgccaaactgaacggctggacatctaccaaagatgggtagatatcctggtgtccact
ggctgggcttatccttgcttttgtacggaggaggagctggaggaagaaagggagcagctg
atgaagcagggggaaacccctaggtatcttggacgctgccgtaacctcgacgaagcagag
cggcaggccaagctggctcagggattgcggcccactatcaggttcagggttcctgaacac
cgggtgttcgtggttgaggatttggtccgggggcgggtagcgttcgaaagtgaaaacatg
ggagatttcataatagtcaagtctgacgggttgccaacctacaacttcgccgtcgttatc
gacgatcatctgatggggataacccacgtcatacgggctgaagagcatctttccaatacg
ccgcgccagctcatgatctacgaagcattagggcttgaaccgccgaagtttgctcatata
tcgttgatactgggggacgatcgccagaagatgagcaaaaggcatggggcaacttcggta
attcaatacagacagcaaggatacctgccggaggctctggttaatttcttagctcttctt
ggctgggcgcctgaaggcgaagaagagataatgtccctggcggatatagccaacagtttt
tctctggaacgagtggcgaagaatcccgcagtctttgacgtagataagctgaactggata
aatcagcagtacatcaaacggaaatcgactgaagaactcaaagaactgctatggcctttt
atagaaagggcgggataccgggatgaggtaaagtccttaggtgatgagaaatataccttg
ctggttgaaaccatgcgcgattatttggtgtgcttgtcggatatcacagacaagcttgac
cttgtctttaaggatgccgaacctgaccatgaagccgaaaaggttctcctacaagagggt
gtggttcaggttttgcggctttgctctgagcgcatcctggatcaggaggcgagtccccaa
gaaatggacaagtttctgaaaagcttggtcaaggatgctggcgtatcagccaagaaggtg
tatatgcctttgcgggcggcgctcacggggaaagtcaaagggccggaactgccttatttg
atggccttgtggggaacgaatgaggtaagaaggcgtttggagcgagctgtaaagagaacg
gaaaccgaaagctga

DBGET integrated database retrieval system