KEGG   Serratia liquefaciens: M495_00105Help
Entry
M495_00105        CDS       T02740                                 

Gene name
malS
Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
slq  Serratia liquefaciens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:slq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(21838..23907)
Genome map
AA seq 689 aa AA seqDB search
MKRLTLPLLMLLSPAAMANWTLQSFPAFDGTSADGLFTSHATLPKGELPLKIYQDQQCWQ
PTAPVKLNQTLSLQPCGDNPPVNWRLFRTGEYQVRIDTRSGTPTLQLSLKTAAEIATAAA
THTCQRWDGKPVTLDVAATFDEGELVRDFYSGQTAKVSQGKITLQPAAGSGGLLLLESAG
SEKPAPFNWHNATVYFALTDRFENGNPANDHSYGRRSDGMQEIGTFHGGDLAGLMNKLDY
LQQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYALDWTRLDANMGSEQDLRTLV
DQAHQRGIRILFDVVVNHVGYATLADMQTFQFGSLYLKEEEIEKTLGKHWGDWRPGPGQN
WHSFNDYINFSDKAGWSSWWGKNWIRTDIGDYDPPGYNDLTMSLAFLPDIKTEAPGASGL
PLFYRHKPDTAAREIPGATTRDYLTTWLSQWVRDYGIDGFRVDTAKHVEKPTLALLKQRA
TAALAEWKAAHPQQALDDAPFWMTGEAWGHGVMKSDYYQNGFDAMINFDFQDQASQALAC
FSNIDATYRQMADKLQDFNVLSYISSHDTRLFFASDAKGSLTLQQRAADLLLLALGAVQI
YYGDESGRDLGPTGSDPLQGTRSDMNWAELQGSKAPLLAHWQRLGQFRARHPAIGAGTQQ
SQQTAHYYAFSRRLGDDKVMVAWVGDRSQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcctgacccttcccctgctgatgctgctgtcgcctgcggcaatggcaaactgg
acgctgcaaagcttcccagcctttgacggtacttccgccgacggcttgttcaccagccac
gccacgctgcccaaaggcgaactgccgctgaaaatttaccaagaccagcaatgctggcag
ccaactgcgccggtcaaactgaaccagacgttgtcactgcaaccctgcggcgataacccg
ccggttaactggcggctgttccgcaccggggaatatcaggtgcgcatcgacacgcgcagc
ggcacgccgacgttacaactcagtctgaaaaccgcagcggaaatcgccactgccgccgcc
acgcacacctgccaacgctgggacggtaaaccggtcacccttgacgtcgcggcaaccttt
gacgaaggcgaattggtacgcgatttctattcaggccaaacggcaaaggtcagccagggc
aaaatcaccctgcaacccgccgccggtagcggtggattgctgttgttggaatctgccggt
agcgaaaaaccggcgcccttcaattggcacaacgccacggtgtattttgcccttaccgat
cgctttgagaacggcaacccggccaacgaccacagctacggacgccgcagcgacggcatg
caggagatcggcaccttccacggcggcgatctggctggcctgatgaacaaactggattat
ttgcaacagcttggcgtcaatgcgctgtggatcagttcgccgctggagcaaatccacggt
tgggtcggcggcggcaccaaaggagactttccgcattacgcttaccacggctattacgcg
ctggactggacccgactcgatgccaatatgggcagcgagcaagacctgcgcacgctggtc
gatcaggcgcaccaacgcggtatccgcattctgtttgacgtggtagtgaatcacgtcggc
tacgccacgctggcagatatgcagaccttccaattcggttcgctgtatctgaaggaggaa
gaaatcgaaaaaacgttgggtaaacattggggcgactggcgaccaggcccaggtcaaaac
tggcacagcttcaacgattacatcaacttcagcgataaagcgggctggagttcatggtgg
ggcaaaaactggatccgtaccgatatcggtgactacgatccacccggctataacgatctc
accatgtcgctggctttccttccggacatcaaaactgaagcgcccggagccagtggtctg
cccctgttttaccgccataaacccgataccgccgcgcgggagattcccggcgccaccaca
cgcgactacctgaccacctggcttagccagtgggtacgtgactatggcattgacggtttt
cgcgtcgacaccgccaagcacgtagaaaaaccaacgctggcgctattgaaacagcgcgcc
accgcagctctggcagagtggaaagccgcccatccacaacaggcgctggatgatgctcct
ttctggatgaccggcgaagcctggggccatggcgtgatgaaaagcgactattaccagaac
ggcttcgacgcgatgatcaattttgacttccaggatcaggcttcccaggccttggcttgc
ttctccaacatcgatgccacctaccgacagatggccgacaagctgcaggatttcaacgtg
ttgagctacatctcctcgcacgatacccggctgttctttgccagcgatgctaaagggtcg
ctaacgctgcagcagcgcgctgccgatctgttgctgttggcactcggtgcggtgcagatt
tactacggcgatgaaagtggccgtgatctaggccctaccggctcagatccgttgcagggt
acccgttccgatatgaactgggccgagttgcagggtagcaaagctcctctgttggcacac
tggcagcggctgggtcaattccgcgctcgtcacccggcgatcggtgccggcacacagcag
tcgcagcaaacggcacactactatgctttcagccgtcggctcggcgacgataaagtgatg
gtggcctgggtcggcgatcggtcacaataa

DBGET integrated database retrieval system