KEGG   Serratia liquefaciens: M495_00570Help
Entry
M495_00570        CDS       T02740                                 

Definition
(GenBank) endonuclease III (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
slq  Serratia liquefaciens
Brite
Enzymes [BR:slq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     M495_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
128199..129311
Genome map
AA seq 370 aa AA seqDB search
MPARLKRLTIGMLLLCAFSAAAACEWPAWQQYKQFYISEQGRVIDPSSPNRITTSEGQSY
GLFFALVANDRPAFDQLLTWTENNLAAGDLSAHLPAWLWGENEQKQWTVLDSNSASDADL
WIAYNLLEAGRLWKSRRYQTLGTLLLQRIAREEVADIPGLGLMLLPGKVGFVAEDRWRLN
PSYLPPQLLARFAVLNGPWRKMQQTNQRLWLETAPHGFSPDWVVWQVGKGWQPDTVKPNI
GSYDAIRVYLWAGMLADDDEHKAALLKQLQPMAQLTAQQGVPPEKTDTASGKTHGDGPVG
FSASMLPMLAHESEALQVQRQRIKQNPPGDRAYFSASLALFGQGWDQQRYRFNRQGELQP
SWGGQCVTSE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgaggttgaagcgtctgaccatcggcatgctgctgctgtgcgcattcagcgcg
gcggcagcctgtgaatggccggcctggcaacagtacaaacagttttatatcagtgagcag
gggcgagtgatcgatccgagcagtcctaaccgaatcaccacctcggaaggccagagttac
ggactgttcttcgcgctggtggcgaacgatcggcctgctttcgatcaattgctgacatgg
acggaaaacaatctggccgcgggcgacctcagtgcgcatttgcccgcctggttgtggggc
gaaaacgaacaaaaacagtggacggtgctggacagcaattcggcatccgatgccgacctg
tggattgcctacaatttgctggaagccggtcggttgtggaaaagccgccgttatcaaacc
cttggcaccctgttgttgcaacgtatcgctcgtgaagaagtggcggatatcccggggctg
gggttgatgctgttaccgggcaaagtcggcttcgtggcggaagatcgctggcgcctcaat
ccgagctatttacccccgcaactgctggcacgttttgccgtgctgaatggcccatggcgg
aagatgcagcaaaccaaccagcggttgtggttggaaactgcgccgcacggcttttcgccg
gactgggtggtgtggcaggtcggcaaaggctggcagccggataccgtcaaaccgaatatc
ggcagttatgacgccatcagggtttatttgtgggccggcatgctggcggacgacgatgaa
cataaggcggcgttgctcaagcaactgcaacctatggcgcagctaacggctcagcaaggc
gtgccgccggagaaaaccgacactgccagcggtaaaacccacggcgatggtccggtgggt
ttctcggcgtcgatgttgccgatgttggcgcacgagtcagaggccttgcaggtgcagcgc
caacgtatcaaacaaaacccgcctggcgatcgggcctatttcagcgcctcgttggcgctg
tttggtcagggatgggatcaacaacgttatcgttttaatcggcagggtgaacttcaaccc
tcctggggcggccaatgcgtaacttccgaataa

DBGET integrated database retrieval system