KEGG   Serratia liquefaciens: M495_02660Help
Entry
M495_02660        CDS       T02740                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
slq  Serratia liquefaciens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M495_02660
Enzymes [BR:slq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     M495_02660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566931..568253
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLNEAEIRFFINGIRDNVVSEGQIAALAMTIYFHDMTMPERVALT
MAMRDSGTVLDWKSLSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFNIFPDDNAFRKIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSADLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAKDDADARAKL
QAVLDNGKAAEVFGRMVAAQQGPTDFVERYDSYLPAATLSKPVYAEKKGIISAMDTRALG
MAVVSLGGGRRRATDSIDYSVGLTEMARLGDKVDTQQPLAVIHANDEETWQQAAEAVRSA
MVLSDKAPEVTPVVYKRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctggcccaagaaattatccgtaagaaacgtgacggtcagccgttgaacgaagca
gaaattcgctttttcatcaatggcatccgtgacaacgtcgtttcagaaggtcaaattgcc
gcgctggcgatgaccatttatttccacgatatgaccatgccggagcgcgtggcgctgacc
atggcaatgcgtgattccggtaccgtgctggactggaaaagcctgtcactgaacgggcca
ctggtcgacaagcactccaccggcggcgtgggcgatgtcacttcgctgatgctgggcccg
atggtggcggcttgcggcggctatgtgccgatgatctccggccgtggtttgggccatacc
ggcggtacgctggacaagctggaagcgatcccgggctttaatatcttcccggacgacaat
gccttccgcaaaattattcaggacgtgggcgtggcgattatcggccaaaccagctcgctg
gcaccggcggacaaacgcttctacgcgacccgtgatatcactgctaccgtagattccatt
ccgctgatcaccgcctctattctggcgaagaagctggcggaaggcctggatgcgttggtg
atggacgtcaaagtcggttccggtgcctttatgccaacctacgcactgtcggccgatttg
gcgcaggcgattgttggcgtagccaacggcgccgggtgcaaaaccaccgcgctgttgacc
gacatgaaccaggtgctggcctccagcgccggtaacgccgtggaagttcgcgaagccgtg
cgcttcctgaccggcgaataccgcaacccgcgcctgctggaagtgacgatggcgctgtgc
gtggaaatgctgctttccggtggcctggcgaaagatgatgccgatgcgcgtgccaaactg
caggcagtgctggacaatggtaaagcggcagaagtgtttggccgtatggtcgccgcacag
cagggcccgaccgatttcgtcgagcgctacgacagctatctgcctgccgcaaccctcagc
aagccggtttacgctgagaaaaaaggtatcatcagtgcaatggatacccgtgcactgggc
atggcggtggtgtccctgggcggcggtcgtcgccgtgcaaccgacagcatcgactacagc
gtgggcctgactgagatggcgcgcctgggcgacaaagtggatacccagcagccgctggcg
gtgatccatgccaacgacgaagagacttggcagcaggcggccgaagcggtacgcagtgcg
atggtgctgagcgacaaagcgccggaagtgacgccagtagtctacaagcgcatcacggaa
taa

DBGET integrated database retrieval system