KEGG   Serratia liquefaciens: M495_05210Help
Entry
M495_05210        CDS       T02740                                 

Definition
hypothetical protein
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
slq  Serratia liquefaciens
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M495_05210
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M495_05210
   00650 Butanoate metabolism
    M495_05210
  Amino acid metabolism
   00360 Phenylalanine metabolism
    M495_05210
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M495_05210
   00622 Xylene degradation
    M495_05210
   00621 Dioxin degradation
    M495_05210
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M495_05210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1121611..1122558)
Genome map
AA seq 315 aa AA seqDB search
MSNSAQIATAIIGSGNIGTDLMIKILRHGQHLKMAAMVGIDPASDGLARANRLGVATTSE
GIDGLLALPDFSEIKVVFDATSAGAHAHHNKLLQQYGVRVIDLTPAAIGPYVVPVVNLAT
LGDAPNLNMVTCGGQATIPMVAAVAGVTDVYYAEIVASVSSRSAGPGTRANIDEFTETTA
LALQSVGGARRGKAIIILNPAEPPLMMRDTVFCLTPPSDRQAITEAVVAMVAKVQEYVPG
YRLKQEVQFETIAPADAHLYPDLGPQGGLKVSIFLEVEGAAHYLPAYAGNLDIMTSAALA
CGEHIARRLLQGQGA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactcagcgcaaattgccactgcaatcatcggttcgggcaacatcggcaccgat
ctgatgattaagatcctgcgccacggtcagcacttgaaaatggctgcgatggtcggaatc
gatcctgcctccgacggcctggctcgtgcgaatcggctgggcgtggcgacgacgtccgaa
ggcattgatggcctgctcgcgctgcccgatttcagcgaaatcaaagtggtttttgacgcc
acttcggccggggcgcacgcgcaccacaataagttgttgcaacagtacggtgtacgggta
atcgacctgaccccagcagccatcggcccctacgtggtaccggtagtcaatctggcaact
ctgggcgacgcccccaatctgaatatggtcacctgcggcggacaggccaccattccgatg
gtggccgccgtcgccggcgtcaccgatgtttactatgccgagatcgtcgcttcggtctcc
agccgttctgccgggcccggcactcgcgcaaacatcgacgaatttaccgaaaccaccgcg
ctggcactgcaaagcgtaggcggcgcaaggcgcggcaaggccatcattatcctcaacccg
gccgaaccgcccttgatgatgcgcgataccgttttctgcctgacgccaccgagcgatcgg
caagcaatcaccgaggcggtggttgccatggtcgccaaagtgcaagagtacgttcccggc
tatcgactcaagcaggaagtccagtttgaaaccatcgccccggccgatgcgcacctttac
ccggatctgggtccgcagggtggcctgaaagtctccatcttcctggaggtcgaaggggcc
gctcactatttaccggcctacgccggcaacctcgacatcatgacgtcagccgcactggcc
tgcggtgagcatatcgcaaggcgtttgctgcaaggtcagggagcatga

DBGET integrated database retrieval system